KEGG   Mus musculus (mouse): 104080
Entry
104080            CDS       T01002                                 

Gene name
Nxph4, 1110036M10Rik, AI851051
Definition
(RefSeq) neurexophilin 4
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Neurexophilin
Other DBs
NCBI-GeneID: 104080
NCBI-ProteinID: NP_899120
MGI: 1336197
Ensembl: ENSMUSG00000040258
Vega: OTTMUSG00000035297
UniProt: Q8BTD1 G3X9N5
Position
10; 10 D3
AA seq 304 aa
MRLLPEWLLLLFGPWLLRKAVCGQIVESGRPQYLDLRPAMAGGGARGQQLPAPASSEGLG
MARSWSWAWPANHTGALAKPGTAGGPSVPRTKRKPSIKAARAKKIFGWGDFYFRVHTLKF
SLLVTGKIVDHVNGTFSVYFRHNSSSLGNLSVSIVPPSKRVEFGGVWLPGPASHPLQSTL
ALEGVLPGLGPPLGMAGQGLGSNLGGALAGPLGSALGVPGAKESRAFNCHVEYEKTNRAR
KHRPCLYDPSQVCFTEHTQSQAAWLCAKPFKVICIFVSFLSFDYKLVQKVCPDYNFQSEH
PYFG
NT seq 915 nt   +upstreamnt  +downstreamnt
atgcggctgctcccggaatggctcctcttgctctttggtccttggctccttaggaaggct
gtctgtggccagatcgtggagtccgggaggccccagtacctagacttgcgtcccgccatg
gccggagggggcgcccgcggccagcagctcccagcgcccgcatcttccgagggcctgggc
atggcgcgctcctggagctgggcttggccggctaaccacaccggggcgctggccaagcca
gggacagccggtggcccgtccgtgccgcgcaccaagaggaagccatccattaaagcggcc
cgagccaagaagattttcggctggggggacttttactttcgtgtgcataccctcaagttc
tcgctgttggtgaccggcaagatcgtggaccatgtgaacggtaccttcagtgtgtacttc
cgtcacaattcgtccagcctgggtaacctaagcgtcagtatcgtgccgccctccaagcgt
gtggagttcgggggcgtctggttgcctgggcctgcctcccaccctctacagtccacgctg
gcacttgaaggggtgcttcctggattggggccccctctggggatggcggggcaggggctg
gggagcaaccttgggggcgcacttgccggcccactcggaagcgcgctaggagttcctggg
gccaaagagtcgcgcgcttttaattgccacgtggaatatgagaagacaaaccgcgctcgc
aagcaccgcccgtgcctgtacgacccgtcgcaggtgtgcttcaccgagcacacgcagagc
caggccgcctggctctgcgccaagcccttcaaagtcatctgtatcttcgtctccttcctc
agttttgactacaaactggtgcagaaggtgtgcccagactataacttccagagtgagcac
ccctactttggataa

DBGET integrated database retrieval system