KEGG   Mus musculus (mouse): 104099
Entry
104099            CDS       T01002                                 

Gene name
Itga9, (alpha)9, 2610002H11Rik, 6720458D17Rik, AI461869, D130073C02, D9Ertd428, D9Ertd428e
Definition
(RefSeq) integrin alpha 9
  KO
K06585  integrin alpha 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104099 (Itga9)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104099 (Itga9)
   04514 Cell adhesion molecules
    104099 (Itga9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104099 (Itga9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104099 (Itga9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104099 (Itga9)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104099 (Itga9)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104099 (Itga9)
   05414 Dilated cardiomyopathy
    104099 (Itga9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    104099 (Itga9)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   104099 (Itga9)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 104099
NCBI-ProteinID: NP_598482
MGI: 104756
Ensembl: ENSMUSG00000039115
Vega: OTTMUSG00000033312
UniProt: B8JK39
Position
9 F3; 9 70.32 cM
AA seq 1036 aa
MGGPAAARTGAGGLRALLLALVAAGVPAGAYNLDAQRPVRFQGPSGSFFGYAVLEHFHDN
TRWVLVGAPKADSKYSTSVKSPGAVFKCRVHTNPDRRCTELDMARGRTRGAPCGKTCRGD
RDDEWMGVSLARQPRADGRVLACAHRWKNIYYEADHILPHGFCYLIPSNLQAKGKVLIPC
YEEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTLKVLNLTDNTYFKLNDEAI
MNRRYTYLGYAVTAGHFSHPSITDVVGGAPQDEGIGKVYIFRADRRSGTLIKIFQASGKK
MGSYFGSSLCAVDLNMDGLSDLLVGAPMFSEIRDEGQVTVYLNQGHGALEEQLTLTGDAA
YNAHFGESIANLGDIDDDGFPDVAVGAPKEEDFAGAVYIYHGDANGIVPKYSMKLSGRRL
NPTLRMFGQSISGGIDMDGNGYPDVTIGAFLSDSVVLLRARPVITVDVSIFLPGSINITA
PQCHDGQQPVNCLNVTVCFRFHGKNVPGEIGLNYNLTADVAQKEKGQLPRVYFVLFGETA
GQVSERLQLSHMDEVCHHYVAHVKRRVQDVISPIVFEAAYSLDEHVMGEEDRELPDLTPV
LRWKKGQRISQKNQTVFERNCQSEDCAADLQLRGKLLLSSVDEKTPHLALGAVKNISLNI
SISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKY
EFSVIFDTSHLSGEEEILSFIVTAQSGNLERSEALHDNTLTLTVPLVHEVDTSITGIVSP
TSFVYGESVDASNFIQLDDQECHFQPVNITLQVYNMGPSTLPGSSVSISFPSRLSPGGAE
MFQVQDMVVSQEKGNCSLQRNPTPCIIPQEQENIFHTIFAFFSKSGRKVLDCEKPGSFCL
TLHCNLSALPKEESRTINLYMLLNTEILKKDSSSVIQFMARAKVKVEPALRVVEIANGNP
EETLVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEK
NRKENEDGWDWVQKNQ
NT seq 3111 nt   +upstreamnt  +downstreamnt
atgggcggcccggctgcggcgcggaccggcgccggagggctccgcgcgctgctgctggcg
ctggtggccgcgggggtcccggccggcgcctacaacctggacgcgcagcgcccggtacgc
ttccagggcccctcaggctccttcttcggctacgcggtgctggagcacttccacgacaac
acgcgctgggtcctcgtgggtgcaccgaaggcagattctaaatatagcacttcagtaaag
tctcctggagctgtgtttaagtgtcgtgtccataccaaccctgaccggagatgcaccgag
ctggacatggctcgagggaggactcgtggtgcgccctgtgggaagacctgcaggggagac
cgggatgacgagtggatgggggtgagcctggcccggcagcccagagcagatggccgtgtt
ttggcctgtgcccatcgttggaagaacatctactacgaagcagaccacatcctgccccat
ggattctgctacctcatcccttccaacctccaggccaaaggcaaggtgctgattccctgc
tacgaagagtataagaagaagtatggggaagaacatggctcctgccaggccggaatagca
ggcttcttcacagaggaactggtggtcatgggtgccccaggctcgttttattgggctggg
acactcaaggtgctgaacctcacggacaacacatattttaagttgaacgatgaagcgatt
atgaacagacggtatacttatctgggctatgcagtgacggctggccacttctctcatcca
tccatcactgatgtggtagggggtgccccacaggatgaaggcattggaaaggtttatata
tttagagctgaccgaagatcagggaccttaataaagatctttcaggcatcaggaaaaaag
atgggctcttacttcggctcctccttgtgtgcagtcgacctgaacatggacggcctctct
gacttgctcgtgggggctcccatgttttctgagatcagagatgaggggcaggtcaccgtc
tacctcaaccaaggacatggagccctcgaggaacagctgaccctgactggagatgccgcc
tacaacgcgcactttggggagagcatcgccaacctgggcgacattgatgatgacgggttc
ccagatgtggctgtcggggcacctaaggaggaggactttgctggcgcagtctacatctat
catggtgatgccaatgggattgtccccaagtactcaatgaagctgtctgggaggaggcta
aacccgaccctgcggatgtttgggcagtccatatcagggggcattgatatggatggaaat
ggctatcctgatgtcaccatcggagccttcctgtccgacagcgtggttctcctcagggcc
agaccggtcatcacggtggatgtctccatcttcctgccaggctccatcaacatcacagca
cctcagtgtcacgatggacaacagcctgtgaactgcctgaatgtcaccgtgtgcttccgg
ttccatggcaagaatgtaccaggagaaatcggtctgaactacaatctgacggctgatgtg
gcacagaaggagaagggccagctgcccagagtctattttgtgttgtttggagagacggca
gggcaggtctcagaaaggctgcagctgtcccacatggacgaagtgtgtcatcactacgtg
gcccacgtcaagcggagagtccaggatgtcatcagccccattgtgtttgaagccgcctac
agcctggatgagcatgtgatgggtgaggaagaccgggagctgccagacctgacaccagtg
cttcgctggaagaagggacaaaggatctcccagaagaatcagacagtttttgaaaggaat
tgccaatctgaggactgtgctgccgacctgcagcttcgggggaaactcctgctttccagt
gttgacgagaaaaccccacacctggctttgggggctgtgaaaaatatctctctaaacatc
tccatctccaaccttggagacgacgcctatgatgccaacgtgtcctttaatgtctccagg
gaacttttcttcatcaacatgtggcagaaggaggagatgggcatttcctgtgagctgctg
gaatcagacttcctcaagtgcagtgtgggatttcctttcatgaggtcaaagtctaagtat
gaattcagtgtcatctttgatacaagccacctgtctggggaagaggaaattctcagcttc
atcgtgactgctcagagtggcaacttggagcgctctgaagccctgcatgacaacactctc
acactgacagtgcccctggtgcatgaagtggacacgtccatcactggaattgtgtcccca
acctccttcgtgtatggcgagtctgtggacgcatccaacttcattcagctggatgaccag
gagtgtcatttccaaccagtcaacattactctccaggtctacaacatgggtcccagcacc
cttcctgggtcatctgtcagcatctccttccccagccggctgtcacctggtggcgcagag
atgtttcaggtccaggacatggtggtgagccaagagaagggtaactgctctctacaaaga
aacccgaccccctgcatcatccctcaagaacaagagaacatcttccacaccatatttgct
ttcttctccaagtctggaagaaaagtgttggactgtgaaaagccagggagcttctgccta
acgttgcactgcaaccttagtgctcttccgaaagaggagagccgcaccatcaacctatac
atgctactgaacacagagatactgaagaaggacagctcctctgtcatccagttcatggct
cgagccaaggtgaaggtggagcctgccctgagagtggtggagatagctaacgggaaccca
gaagagactctggtggtcttcgaggccttgcacaatctggaaccccgtggctacgttgtg
gggtggatcatcgccatcagtttgctggtggggatcctcatttttctgctgctggctgtg
ctcctgtggaagatgggcttcttccgcagaaggtacaaagagatcattgaagctgagaaa
aaccggaaagagaatgaagatggttgggactgggtccagaaaaaccagtga

DBGET integrated database retrieval system