KEGG   Mus musculus (mouse): 104112Help
Entry
104112            CDS       T01002                                 

Gene name
Acly, A730098H14Rik, AW538652
Definition
(RefSeq) ATP citrate lyase
  KO
K01648  ATP citrate (pro-S)-lyase [EC:2.3.3.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104112 (Acly)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    104112 (Acly)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     104112 (Acly)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104112 (Acly)
  Exosomal proteins of bladder cancer cells
   104112 (Acly)
  Exosomal proteins of melanoma cells
   104112 (Acly)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Citrate_bind Citrate_synt Ligase_CoA CoA_binding ATP-grasp_2 Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 104112
NCBI-ProteinID: NP_598798
MGI: 103251
Ensembl: ENSMUSG00000020917
Vega: OTTMUSG00000006279
UniProt: Q91V92
Position
11; 11 D
AA seq 1091 aa AA seqDB search
MSAKAISEQTGKELLYKYICTTSAIQNRFKYARVTPDTDWAHLLQDHPWLLSQSLVVKPD
QLIKRRGKLGLVGVNLSLDGVKSWLKPRLGHEATVGKAKGFLKNFLIEPFVPHSQAEEFY
VCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNTEDIKRHLLVHAPEDKKEV
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVYILDLAAKVDATADYICKVKWGDIEFPP
PFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNE
LANYGEYSGAPSEQQTYDYAKTILSLMTREKHPEGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALG
HRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQGKSA
TLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILI
PVFKNMADAMKKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLI
KKADQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYVSRSGGMSNEL
NNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTPGVKMIVVLGEIGGTEEYKICRG
IKEGRLTKPVVCWCIGTCATMFSSEVQFGHAGACANQASETAVAKNQALKEAGVFVPRSF
DELGEIIQSVYEDLVAKGAIVPAQEVPPPTVPMDYSWARELGLIRKPASFMTSICDERGQ
ELIYAGMPITEVFKEEMGIGGVLGLLWFQRRLPKYSCQFIEMCLMVTADHGPAVSGAHNT
IICARAGKDLVSSLTSGLLTIGDRFGGALDAAAKMFSKAFDSGIIPMEFVNKMKKEGKLI
MGIGHRVKSINNPDMRVQILKDFVKQHFPATPLLDYALEVEKITTSKKPNLILNVDGFIG
VAFVDMLRNCGSFTREEADEYVDIGALNGIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDD
ISYVLPEHMSM
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccaaggcaatttcagagcagaccggcaaagaactcctgtacaagtacatctgc
accacctcggccatccagaaccggttcaagtacgcccgggtgactcccgacacagactgg
gcccatctgctgcaggaccacccgtggctgctcagccagagcttggttgtcaagccagac
cagttaatcaaacgtcgaggaaagcttggcctcgtcggggtcaatctctctctggatgga
gtcaaatcctggctaaaacctcgcctgggacatgaagccactgtcggcaaggccaaaggc
ttcctcaagaactttctcattgaacccttcgtcccccacagtcaggcggaggagttctac
gtgtgcatctatgctacccgggaaggagactacgtcctgttccaccatgaagggggtgtg
gatgtgggcgatgtggatgccaaagcccagaagctgcttgtgggtgtggacgaaaagctg
aataccgaggacattaagagacacctgttggtccatgcacctgaggacaagaaagaagtc
ctggccagcttcatctctggtctattcaatttctacgaggatctgtacttcacctacctt
gagatcaacccccttgtggtgaccaaagatggtgtctacatccttgacttggcggccaag
gtggatgccacagctgactacatctgtaaagtcaagtggggtgatatagagttccctccc
ccctttgggcgtgaggcgtaccccgaggaagcctacattgcagacctggatgccaaaagt
ggagcaagcttgaagctgaccttgctgaaccccaaggggcggatctggaccatggttgct
gggggtggcgcctccgtcgtgtacagtgacaccatctgtgatcttggaggtgtcaatgaa
ctggcgaattacggggaatactcgggtgcccccagtgaacaacagacctatgactatgcc
aagaccatcctctcacttatgactcgagagaagcacccagaaggcaagatcctcatcatt
ggaggcagcattgcaaacttcaccaatgtggccgccaccttcaagggcattgtgagagcg
attcgagattaccagggtcccctgaaggagcatgaggtcaccatctttgtccgaagaggt
ggccccaactatcaagagggattacgagtgatgggagaagttgggaagaccactgggatc
cccatccatgtctttggcacagaaactcacatgacggccattgtgggcatggccctgggc
caccggcccattcccaaccagccacccacagcagctcacactgccaacttcctccttaat
gccagcgggagcacatcgactccagcacccagtaggacagcatctttttctgagtcccga
gctgatgaagtggcacctgcaaagaaagccaagccagctatgccccaaggaaagagtgcc
accctcttcagccgacataccaaggccatcgtgtggggcatgcagacccgggctgtgcag
ggcatgctggactttgactacgtgtgttcccgagacgagccctcagtggctgccatggtc
taccctttcactggggatcacaagcagaagttttactggggacacaaggaaatcctgatc
cctgtcttcaagaacatggctgacgccatgaagaagcacccggaggtagacgtgctgatc
aactttgcgtctctgcggtccgcttacgacagcaccatggagaccatgaactatgcccag
atccgcaccatagccatcatagcagaaggtatccctgaggccctcacacggaagctcatc
aagaaggccgaccagaagggagtgaccatcattgggccagctacggttgggggcattaag
cctggatgctttaagatcgggaatactggtggaatgctggacaacatcctggcctccaaa
ctgtaccgcccaggcagcgtggcctacgtctcacgttcaggaggcatgtctaatgaactc
aataacatcatctctcggaccacagatggtgtctatgagggcgtggccatcggcggggac
aggtaccctgggtccacattcatggatcacgtgctgcgctaccaggacactccaggagtc
aagatgatcgtagttcttggggagatagggggcacagaggaatataagatctgccggggc
atcaaggagggccgcctcaccaagccagtggtctgctggtgtatcgggacctgtgccacc
atgttctcctccgaggtccagtttggccatgctggagcttgtgccaaccaggcttctgaa
actgcagtagccaagaaccaggccttgaaggaagcaggagtgtttgtgccccgaagcttc
gatgagcttggagaaatcattcagtctgtgtatgaagatctggtggccaaaggagccatt
gtacctgcccaggaagtgccacctccaacagtgcccatggactactcttgggccagagag
ctgggtttgatccgaaaacctgcctcattcatgaccagcatctgtgatgagcgagggcag
gagctcatttatgcgggcatgcccatcaccgaggtcttcaaggaggagatgggcatcggt
ggtgtcctcggcctcctctggttccagagaaggttgcccaagtattcctgccagttcatt
gagatgtgtctgatggtcacagctgatcacgggccagctgtctctggagcccataacacc
atcatctgtgctcgggctgggaaggacctggtctccagcctcacctcagggctgctcacc
attggagaccggtttgggggtgccttggatgccgcagcaaagatgttcagtaaagccttt
gacagcggcatcattcccatggagttcgtcaacaagatgaagaaggaggggaagctgatc
atgggcatcggccatcgagtaaaatcgataaacaacccagacatgcgagtgcagatcctc
aaggacttcgtcaaacagcacttccccgccaccccgctgctcgactatgccctggaagtg
gagaagattaccacctccaagaagccaaatcttatcctgaatgtggacggcttcatcggc
gttgcgtttgtggacatgctcaggaactgtggctccttcacccgggaggaagctgatgaa
tatgttgacattggagccctcaatggcatctttgtgctaggaaggagtatgggcttcatt
gggcactaccttgaccagaagaggctgaagcaagggctgtatcgtcacccctgggatgac
atttcctatgttcttccagaacacatgagcatgtaa

DBGET integrated database retrieval system