KEGG   Mus musculus (mouse): 104156
Entry
104156            CDS       T01002                                 

Gene name
Etv5, 1110005E01Rik, 8430401F14Rik, ERM, er
Definition
(RefSeq) ets variant 5
  KO
K15593  ets translocation variant 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    104156 (Etv5)
  09162 Cancer: specific types
   05215 Prostate cancer
    104156 (Etv5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    104156 (Etv5)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    104156 (Etv5)
SSDB
Motif
Pfam: ETS_PEA3_N Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 104156
NCBI-ProteinID: NP_076283
MGI: 1096867
Ensembl: ENSMUSG00000013089
Vega: OTTMUSG00000036714
UniProt: Q9CXC9
Position
16; 16 B1
AA seq 510 aa
MDGFCDQQVPFMVPGKSRSEDCRGRPLIDRKRKFVDTDLAHDSEELFQDLSQLQEAWLAE
AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGAKYGEKCLYNY
CAYDRKPPSGFKPLTPPATPLSPTHQNSLFPPPQATLPTSGLTPGAGPVQGVGPAPTPHS
LPEPGSQQQTFAVPRPPHQPLQMPKMMPESQYPSEQRFQRQLSEPSHPFPPQSGVPGDSR
PSYHRQMSEPIVPAAPPPLQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYC
ADSEVPNCQSSYMRGGYFSSSHEGFPYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGP
PYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYD
KLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECPLNEEDT
LPLTHFEDNPAYLLDMDRCSSLPYTEGFAY
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggatgggttttgtgatcagcaagtcccttttatggtcccagggaaatctcgatcagag
gactgtcgagggcgacctttgattgacagaaagaggaagtttgtggacacagatctggct
cacgattctgaagagttgtttcaggatcttagccagctgcaggaggcttggttagctgaa
gcacaagttcctgatgatgagcagtttgtcccagattttcagtctgataacttggtgctt
catgctccacctcccaccaagatcaaacgggagctgcacagcccctcctccgagttgtcg
tcctgtagccacgagcaggctcttggtgctaagtatggagaaaagtgcctctacaactat
tgtgcctacgataggaagcctccctctgggttcaagccattaaccccgcccgccactcct
ctgtcacccacccatcagaattccctatttcccccacctcaggcaactctgcccacctca
ggtctcacccctggagctggcccagttcaaggggtgggtcctgccccgactcctcactca
cttccagaacctggatcacagcaacaaacatttgcggtcccccggccaccacatcagccc
ctgcaaatgccaaagatgatgcctgaaagccagtatccatcagaacagagatttcagcga
cagctgtctgagcccagccatcccttccctcctcagtcaggagttcctggagatagtcgc
cccagctaccaccggcagatgtcagagcccattgtccccgcagctccgccaccccttcag
ggattcaagcaggaataccatgacccactgtatgaacatggggtccctgggatgcctggt
cctccagcacatgggttccagtcacccatggggatcaagcaggagccccgagattactgt
gctgactcagaagtgcctaactgccagtcatcctacatgagaggcgggtatttctccagc
agccatgaaggattcccgtatgagaaggaccccaggctgtactttgatgatacttgcgtg
gtacccgagagactggaaggcaaagtcaagcaggagcccaccatgtatcgagaggggcct
ccttatcagagacgaggctctctgcagctgtggcagttccttgtcaccctcctggatgac
ccagccaatgcccacttcatcgcctggactggccgaggcatggaatttaagctcatagaa
ccggaagaggttgctcgccgttggggtatccagaagaatcggccagccatgaactatgac
aagctgagccgctctctccgctattactatgaaaagggcatcatgcagaaggtggctggg
gaacgctacgtctacaaatttgtgtgtgacccggatgcactcttctctatggccttcccg
gacaatcagcgcccgttcctgaaggcagaatccgaatgccccctcaatgaggaggacacg
ctgcctctgactcactttgaagacaaccctgcttacctcctggacatggatcgctgcagc
agcctcccctacaccgaaggcttcgcttactaa

DBGET integrated database retrieval system