KEGG   Mus musculus (mouse): 104263
Entry
104263            CDS       T01002                                 

Symbol
Kdm3a, 1700105C21Rik, C230043E16Rik, JHDM2a, Jmjd1, Jmjd1a, KDM2A, TGSA, Tsga
Name
(RefSeq) lysine (K)-specific demethylase 3A
  KO
K15601  [histone H3]-dimethyl-L-lysine9 demethylase [EC:1.14.11.65]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    104263 (Kdm3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    104263 (Kdm3a)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.65  [histone H3]-dimethyl-L-lysine9 demethylase
     104263 (Kdm3a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    104263 (Kdm3a)
SSDB
Motif
Pfam: JmjC C1_2 zf-UDP Cupin_2
Other DBs
NCBI-GeneID: 104263
NCBI-ProteinID: NP_001033784
MGI: 98847
Ensembl: ENSMUSG00000053470
Vega: OTTMUSG00000057914
UniProt: Q6PCM1
Position
6; 6 C1
AA seq 1323 aa
MVLTLGESWPVLVGKRFLSLSAAEGNEGGQDNWDLERVAEWPWLSGTIRAVSHTDVTKKD
LKVCVEFDGESWRKRRWIDVYSLQRKAFLVEHNLVLAERKSPEVPEQVIQWPAIMYKSLL
DKAGLGAITSVRFLGDQQSVFVSKDLLKPIQDVNSLRLSLTDNQTVSKEFQALIVKHLDE
SHLLQGDKNLVGSEVKIYSLDPSTQWFSATVVHGNPSSKTLQVNCEEIPALKIVDPALIH
VEVVHDNFVTCGNSTRTGAVKRKSSENNGSSVSKQAKSCSEASPSMCPVQSVPTTVFKEI
LLGCTAATPSSKDPRQQNTPQAANSPPNIGAKLPQGCHKQNLPEELSSCLNTKPEVPRTK
PDVCKEGLLSSKSSQVGAGDLKILSEPKGSCIQPKTNTDQESRLESAPQPVTGLPKECLP
AKTSSKAELDIATTPELQKHLEHAASTSDDLSDKPEVKAGVTSLNSCAEKKVEPSHLGSQ
SQNLKETSVKVDNESCCTRSSNKTQTPPARKSVLTDPDKVRKLQQSGEAFVQDDSCVNIV
AQLPKCRECRLDSLRKDKDQQKDSPVFCRFFHFRRLQFNKHGVLRVEGFLTPNKYDSEAI
GLWLPLTKNVVGTDLDTAKYILANIGDHFCQMVISEKEAMSTIEPHRQVAWKRAVKGVRE
MCDVCDTTIFNLHWVCPRCGFGVCVDCYRMKRKNCQQGAAYKTFSWIRCVKSQIHEPENL
MPTQIIPGKALYDVGDIVHSVRAKWGIKANCPCSNRQFKLFSKPALKEDLKQTSLSGEKP
TLGTMVQQSSPVLEPVAVCGEAASKPASSVKPTCPTSTSPLNWLADLTSGNVNKENKEKQ
LTMPILKNEIKCLPPLPPLNKPSTVLHTFNSTILTPVSNNNSGFLRNLLNSSTAKTENGL
KNTPKILDDIFASLVQNKTSSDSSKRPQGLTIKPSILGFDTPHYWLCDNRLLCLQDPNNK
SNWNVFRECWKQGQPVMVSGVHHKLNTELWKPESFRKEFGEQEVDLVNCRTNEIITGATV
GDFWDGFEDVPNRLKNDKEKEPMVLKLKDWPPGEDFRDMMPSRFDDLMANIPLPEYTRRD
GKLNLASRLPNYFVRPDLGPKMYNAYGLITPEDRKYGTTNLHLDVSDAANVMVYVGIPKG
QCEQEEEVLRTIQDGDSDELTIKRFIEGKEKPGALWHIYAAKDTEKIREFLKKVSEEQGQ
DNPADHDPIHDQSWYLDRSLRKRLYQEYGVQGWAIVQFLGDVVFIPAGAPHQVHNLYSCI
KVAEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIYHAVKDAVAMLKASESSL
GKP
NT seq 3972 nt   +upstreamnt  +downstreamnt
atggtgctcacgctcggagaaagttggccagtattggtggggaagcgattcctcagtctg
tccgcagccgaaggcaacgaaggcggccaggacaactgggacttggagcgcgttgccgag
tggccctggctgtcggggaccattcgagctgtttcccacaccgacgttactaagaaagac
ttgaaggtgtgtgtggagtttgatggggagtcttggagaaagagaagatggatagatgtc
tacagccttcagagaaaagcatttttagtagagcataacctggttttggcagaacgaaaa
tcacctgaagttcctgagcaagttattcagtggcctgcaataatgtacaaatctcttcta
gacaaagctggcttgggagccataacttctgttcggtttcttggagatcaacaaagtgta
tttgtttccaaagaccttttgaaacctatacaggatgttaacagtcttcggctttccctt
actgataatcagacagtcagtaaggaatttcaagctttgattgtaaaacatttggatgaa
agccatcttttacaaggtgacaagaaccttgttggttcagaagtaaaaatttatagcttg
gacccatctactcagtggttttcagcaactgttgtacatggaaacccatcatccaaaact
cttcaagtcaactgtgaggagattccagcactgaaaattgtcgacccagcactgattcat
gttgaagttgtacatgacaactttgtgacatgtggtaattctacaagaactggagctgta
aaacgcaagtcttctgagaataacggaagttcggtttctaaacaagcaaaatcttgttct
gaggcctctcccagtatgtgtcctgtacagtctgttcccacaacagtgtttaaggagatc
ctgcttggctgtactgcagcaactccatctagcaaggacccaagacagcaaaatactccc
caggcagccaattctccacctaacattggagcaaaacttcctcaaggatgtcataagcag
aacttaccagaagaactttcttcctgtctaaacacaaaacctgaagtaccgagaacaaaa
ccagatgtctgcaaagaaggattactttcttcaaaatcttctcaggttggagctggagac
ttgaaaattctgagtgagcccaaaggtagctgtatccagcctaaaacaaacactgatcag
gagagcagactggagtctgctccacagccagtcactggccttccaaaggagtgcttgcct
gcaaagacttcctctaaggcagaactggacattgccaccactcctgaactgcagaagcat
ctagaacatgcagcttccacatccgatgacctttcagataagccagaagtgaaagcaggt
gtcactagccttaatagttgtgcagaaaagaaggtcgaaccttcacatttaggttcccag
tcacagaatttaaaggaaacttcagtaaaagtagataatgaaagctgttgtacaagaagc
agtaataaaacccagactcccccagcccggaagtcagttttgacagacccagataaagtc
aggaagctgcagcagagcggagaggcctttgttcaggatgactcctgtgttaacatcgtg
gcacagctgcccaagtgtcgggagtgtcgactagacagcctgcgcaaggataaggaccag
cagaaggactctcctgtgttttgtcgctttttccacttcaggagattacaattcaacaag
catggtgtgttgcgggtagaaggcttcttaacaccaaacaagtatgacagtgaagcgatt
ggcttgtggctgcctttgaccaaaaatgttgtggggactgatttggacacagcaaaatat
atcctggccaatattggagaccacttctgtcaaatggtgatttctgagaaggaagctatg
tcgactattgagccacacagacaggttgcttggaaacgagctgtcaaaggagttagagaa
atgtgtgatgtgtgtgacacaaccattttcaacctgcactgggtgtgccctcggtgtggg
tttggagtatgtgtagattgctaccggatgaagaggaagaactgccaacagggtgctgcc
tacaagactttctcttggataaggtgtgtgaagagtcagatacatgagcctgagaacctg
atgcccacacagattattcctggcaaagccctctacgatgttggagacattgtgcattct
gtcagagcaaaatggggcataaaggccaattgtccctgctccaacaggcagttcaagctc
ttctcaaagccagccttaaaggaagacctgaaacagacatccttgtctggagaaaaacca
actcttgggaccatggtccagcaaagttcccctgttttggagccagtggctgtgtgcggg
gaagcagcctccaagccagccagcagcgtgaagcccacctgtcccaccagcacttcacct
ttaaactggctagctgaccttaccagtgggaatgtcaacaaggagaataaggaaaaacag
ctgactatgccaattttaaagaatgaaatcaaatgccttccacccttgccccctctgaac
aagcccagcacagtcctccatacttttaacagcaccatcttgacacctgtgagcaacaat
aattcaggtttccttagaaatcttttgaattcatccacagcaaagacagaaaatggattg
aaaaacacacccaaaattcttgatgacatctttgcctctttggtgcaaaacaagacttct
tctgattcatccaagaggcctcaaggactgacaatcaagcctagcattcttggctttgac
actcctcactactggctgtgtgacaaccgcctgctgtgcttgcaagaccccaacaataag
agcaattggaatgtttttagggaatgctggaaacaagggcagccagtgatggtgtcgggc
gtgcatcataaattaaacactgaactctggaaacccgagtccttcagaaaagagtttggt
gagcaggaagtagacctagtcaattgtaggaccaatgaaatcatcactggagccacagtc
ggagacttctgggatggatttgaagatgttccaaaccgtttgaaaaacgacaaagaaaaa
gaaccaatggtgttgaaacttaaggactggccgccaggagaagacttcagagacatgatg
ccttccaggtttgatgatctgatggccaacattccactgcctgagtacaccaggcgagat
ggcaaactgaacctggcttccagactgccaaactactttgtacggccagacctgggcccc
aagatgtacaatgcttatggattgatcactccagaggatcggaaatatgggaccacaaat
cttcacttagatgtatctgatgcagccaatgtcatggtttatgtgggaattcccaaagga
cagtgtgaacaagaagaagaagtccttagaaccatccaagatggagattctgatgaactc
acaatcaagagatttattgaaggaaaagagaagccaggagccctttggcacatatatgct
gctaaagacacagagaagataagagaattccttaaaaaggtatcagaggagcagggtcaa
gacaaccctgcagaccatgaccctatccacgatcagagctggtatttagaccgatcgctg
agaaagcgcctctatcaagagtacggcgtgcaaggctgggctattgtacagtttcttggg
gatgtggtgtttatcccagcaggagcgccacatcaggttcataacttatacagctgtatc
aaagtggctgaagactttgtgtctccagagcatgttaaacactgcttctggcttactcag
gaattccgttacttgtcacagactcataccaaccatgaagataaattgcaggtgaaaaat
gttatctaccatgcagtgaaagatgcagttgctatgctgaaagccagtgaatccagtttg
ggcaaaccttaa

DBGET integrated database retrieval system