KEGG   Mus musculus (mouse): 104303Help
Entry
104303            CDS       T01002                                 

Gene name
Arl1, 2310008D22Rik, AU019749
Definition
(RefSeq) ADP-ribosylation factor-like 1
  KO
K07942  ADP-ribosylation factor-like protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    104303 (Arl1)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    104303 (Arl1)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPases
    104303 (Arl1)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arl1/Arl5 [OT]
    104303 (Arl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf Roc Ras G-alpha SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU MeaB ABC_tran AAA_18 FeoB_N
Motif
Other DBs
NCBI-GeneID: 104303
NCBI-ProteinID: NP_080135
MGI: 99436
Ensembl: ENSMUSG00000060904
Vega: OTTMUSG00000035178
UniProt: P61211 Q14AC7
Position
10; 10 C1
AA seq 181 aa AA seqDB search
MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKN
LKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAI
LVVFANKQDMEQAMTPSEMANALGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR
Q
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggtggctttttctcaagtattttttccagtctctttggaaccagagaaatgaggatt
ttaattttgggattagatggtgctggaaaaacaacaattttgtacaggttacaggttgga
gaagttgttactactattcccactattggatttaatgtggagacggtgacatacaaaaat
ctcaaattccaagtttgggacttaggaggacagacaagtatcaggccatactggagatgt
tattattcaaacacagatgcagtcatctatgtcgttgacagttgtgaccgagatcgaatt
ggcatttccaagtctgagttagttgccatgttggaggaagaagagctgagaaaagccatt
ttagtggtgtttgcaaataagcaggacatggaacaggccatgacaccctcagaaatggca
aatgctcttgggttacctgccctgaaggaccggaagtggcagatctttaaaacttcagca
accaaaggcactggccttgatgaggcaatggaatggttagttgaaaccctgaaaagcaga
cagtga

DBGET integrated database retrieval system