KEGG   Mus musculus (mouse): 104318
Entry
104318            CDS       T01002                                 

Gene name
Csnk1d, 1200006A05Rik, AA409348, D930010H05Rik
Definition
(RefSeq) casein kinase 1, delta
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04340  Hedgehog signaling pathway
mmu04390  Hippo signaling pathway
mmu04540  Gap junction
mmu04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104318 (Csnk1d)
   04390 Hippo signaling pathway
    104318 (Csnk1d)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104318 (Csnk1d)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    104318 (Csnk1d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    104318 (Csnk1d)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    104318 (Csnk1d)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104318 (Csnk1d)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   104318 (Csnk1d)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104318 (Csnk1d)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 104318
NCBI-ProteinID: NP_620690
MGI: 1355272
Ensembl: ENSMUSG00000025162
Vega: OTTMUSG00000004159
UniProt: Q9DC28
Structure
PDB: 
5X17 4JJR

Position
11; 11 E2
AA seq 415 aa
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNVSSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggagctgagggtcgggaacaggtaccgactgggccgcaagatcggcagcggctccttc
ggagacatctatctcggtacggacattgctgcgggagaagaagttgccatcaagcttgaa
tgtgtcaaaaccaaacatcctcagctccacattgagagcaagatctacaaaatgatgcag
ggaggagtgggcatccctaccatcagatggtgtggggctgagggggactacaatgtcatg
gtgatggagctactgggacccagcctggaagacctgttcaacttctgttcaaggaagttt
agtctcaaaactgttctgttgcttgctgaccaaatgataagtcgtattgagtacattcat
tcgaagaattttatccaccgagatgtgaagccagataacttcctcatggggctgggaaag
aaaggcaacctggtctacatcattgactttgggctggccaagaagtatcgggatgcacgc
acccaccagcatatcccctatcgagagaacaagaacctcacagggacagcacgctatgcc
tccatcaacacgcaccttggcattgaacaatctcgaagggatgacttggagtctctgggg
tacgtgctgatgtacttcaacctgggctctctcccctggcaggggctgaaggccgccacc
aagaggcagaagtatgagaggatcagtgagaagaagatgtccactcccattgaagtgctg
tgcaagggctatccttctgaatttgccacatacctgaatttctgccgttccttacgtttt
gatgacaaacctgactactcctacctgagacagctcttcagaaatctgttccatcgccaa
ggcttctcctacgactatgtgttcgactggaacatgctcaaatttggtgccagccgggct
gcagatgatgctgagcgggaacgccgggatcgagaagaacgattaagacactcccggaat
ccagccactcgtggcctcccttctacagcttccggccgtctgcggggaacccaggaagtg
gctcccccaacgccccttacccctacctcacacacggccaacacctctccgaggcctgtc
tctggcatggaacgagaacggaaagtgagtatgcggctgcaccgtggggccccagtcaac
gtctcctcatctgatctcacgggccgacaagatacctctcgcatgtccacctcacagatt
cccggtcgggtggcttccagtggtcttcagtctgtcgtgcaccgatga

DBGET integrated database retrieval system