KEGG   Mus musculus (mouse): 104360
Entry
104360            CDS       T01002                                 

Gene name
Isl2, 3110001N10Rik
Definition
(RefSeq) insulin related protein 2 (islet 2)
  KO
K18492  insulin gene enhancer protein ISL-2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    104360 (Isl2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with LIM region
    104360 (Isl2)
SSDB
Motif
Pfam: LIM Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 104360
NCBI-ProteinID: NP_081673
MGI: 109156
Ensembl: ENSMUSG00000032318
Vega: OTTMUSG00000036076
UniProt: Q9CXV0 Q0VAX2
Position
9; 9 B
AA seq 359 aa
MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQ
YLDETCTCFVRDGKTYCKRDYVRLFGIKCAQCQVGFSSSDLVMRARDSVYHIECFRCSVC
SRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPSL
RTHVHKQAEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQ
NKRCKDKKKSILMKQLQQQQHSDKASLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPP
WKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggtggatattatttttcattatccttttctgggtgctatgggggatcattccaagaag
aagcccgggacggccatgtgcgtgggctgcgggagtcagatccacgaccagtttatcctt
cgcgtgtcgcccgacctcgagtggcacgccgcctgcctcaagtgcgcggagtgcagccag
tacctggacgagacgtgcacgtgcttcgtgagagacgggaaaacctactgcaagcgggac
tacgtcaggctgttcggcatcaagtgtgcccagtgccaggtgggcttcagcagcagtgac
ctggtgatgcgggcgcgggacagcgtgtaccacatcgagtgcttccgctgctccgtgtgc
agccgccagctgctccctggagacgagttctcgctgcgggagcatgagctgctctgccga
gctgaccacggcctcctgctggagcgcgctgcggctggcagcccgcgcagccccggcccg
ctccccggcgcccgcggcctgcatctgccagacgctgggtccggacgacagccctcactg
cgcacgcacgtgcacaagcaggcggagaagacaacccgggtacggactgtgctcaacgag
aagcaactgcataccctgcggacgtgctacgccgccaatccgcggccagacgcgctcatg
aaagagcagctagtagagatgaccggcttgagcccgcgggtcatccgcgtgtggtttcag
aacaagcgttgcaaggacaagaagaagtccattctcatgaagcagctacagcagcagcaa
cacagtgacaaggcgagcctccagggactgactgggacgcctctggtggcaggcagcccc
atccgccatgagaacgcggtgcagggcagcgcagtcgaggtgcagacgtaccagccgccc
tggaaagcactcagcgagtttgcactccagagcgacctggaccaacccgcctttcaacag
ctggtttccttctccgagtcaggctccctaggcaactcttccggtagcgacgtgacctct
ctgtcctcgcagctcccggacacccccaacagtatggtacctagtccggtggagacgtga

DBGET integrated database retrieval system