KEGG   Mus musculus (mouse): 104394Help
Entry
104394            CDS       T01002                                 

Gene name
E2f4, 2010111M04Rik, AI427446
Definition
(RefSeq) E2F transcription factor 4
  KO
K04682  transcription factor E2F4/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04218  Cellular senescence
mmu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    104394 (E2f4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104394 (E2f4)
   04218 Cellular senescence
    104394 (E2f4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    104394 (E2f4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    104394 (E2f4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E2F_CC-MB E2F_TDP DUF3584 DivIC GREB1
Motif
Other DBs
NCBI-GeneID: 104394
NCBI-ProteinID: NP_683754
MGI: 103012
Ensembl: ENSMUSG00000014859
Vega: OTTMUSG00000062044
UniProt: Q8R0K9
Position
8; 8 D3
AA seq 410 aa AA seqDB search
MAEAGPQAPPPPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYD
ITNVLEGIGLIEKKSKNSIQWKGVGPGCNTREIADKLIELKAEIEELQQREQELDQHKVW
VQQSIRNVTEDVQNSCLAYVTHEDICRCFAGDTLLAIRAPSGTSLEVPIPEGLNGQKKYQ
IHLKSMSGPIEVLLVNKEAWSSPPVAVPVPPPDDLLQSPPAVSTPPPLPKPALAQPQESS
PPSSPQLTTPTPVLGSTQVSEVACQTSEIAVSGSPGTENKDSGEVSSLPLGLTALDTRPL
QSSALLDSSSSSSSSSSSSSSSSSGPNPSTSFEPIKADPTGVLDLPKELSEIFDPTRECM
SSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLKL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggccgggccacaggcgccgccgcccccggggactccaagccggcacgagaag
agtctgggacttctcaccaccaagttcgtgtcgctcttgcaggaagccaaggacggcgtg
cttgacctcaagctggcagccgacactcttgctgtgcgccagaaacggcggatctacgac
atcaccaacgtgctggaaggcatcggtctgatcgagaagaaatccaagaacagcatccag
tggaagggcgtcgggccaggttgcaatacccgggagatcgctgacaagctgattgagctc
aaggcagagatcgaggagctgcagcaacgagagcaagaactggaccagcacaaggtgtgg
gtgcagcagagcatccggaatgtcactgaggacgtccagaacagctgcttggcctacgtg
actcatgaagacatctgcagatgctttgctggagataccctccttgccatccgggcgcca
tcgggcaccagtctagaggtgcccatcccagagggtctcaatggccagaagaagtaccag
attcacttaaagagcatgagtgggcctatcgaggtgctgctagtgaacaaggaggcctgg
agttcaccacctgtggctgtgcctgtccctccccctgacgatctactccagagtccacct
gctgtttctacacctccacctctgcccaagcctgccttagctcaaccccaagaatcctct
cctccaagcagcccccagctaactacccccactcctgtccttggcagcactcaagtctca
gaggtggcatgccagacatctgagattgcagtgagtggtagccctggaactgagaacaag
gacagtggtgaagtcagctcactcccactgggcctgacagcactggacactcggcctctg
cagtcctctgcactgctggatagtagtagcagcagcagcagcagcagcagtagcagcagc
agcagttcatctggacccaacccttctacctcctttgagcccatcaaagcagaccccaca
ggcgttctggatctccccaaagagctgtcagaaatcttcgaccccacgagagagtgcatg
agctccgagctgctggaagaactgatgtcttcagaagtgtttgcccccctcctccgactt
tctccacctcccggagaccacgattacatctacaacctggacgagagtgaaggtgtctgt
gatctctttgatgttcctgttctcaaactctga

DBGET integrated database retrieval system