KEGG   Mus musculus (mouse): 104457Help
Entry
104457            CDS       T01002                                 

Gene name
0610010K14Rik, 1110020A23Rik, AL033328, AU045833, Bap18
Definition
(RefSeq) RIKEN cDNA 0610010K14 gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-bind_7 Myb_DNA-binding Myb_DNA-bind_6
Motif
Other DBs
NCBI-GeneID: 104457
NCBI-ProteinID: NP_665701
MGI: 1915609
Ensembl: ENSMUSG00000020831
Vega: OTTMUSG00000006039
UniProt: Q9DCT6
Position
11; 11 B3
AA seq 171 aa AA seqDB search
MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVSDSSPAGAKWTETEIEMLRAAVKRFGDD
LNHISCVIKERTVAQIKTTVKRKVYEDSGIPLPAESPKKGPKKMTSGVLSPPNAPPPSSS
SVPEAGVPPIKKQKADVTLSALNDSDANSDLVDVEGLGETPPAKKLNFDQA
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcagcgtccaccaaggttggagagatcttctccgcggccggcgccgccttcacg
aagctcggggagttgacgatgcagctgcatccagtctcggactcttcccctgccggtgcc
aagtggacggagacggagatagagatgctgagggctgctgtgaagcgctttggggacgat
cttaatcacatcagctgtgtcatcaaggaacggacagtggctcagataaagaccactgtg
aagcgaaaagtgtatgaagactccggcatcccccttccagctgagtcacccaagaaagga
cccaagaagatgacgtccggtgtcctctcacctccaaacgcccctccacccagcagctcc
agtgtccctgaagctggggttcctcccataaagaaacagaaggctgatgtgacactcagt
gctctgaacgactccgacgccaacagtgacctggtggatgtcgaagggctaggagaaact
cctccagccaagaaactcaactttgaccaggcctga

DBGET integrated database retrieval system