KEGG   Mus musculus (mouse): 104709
Entry
104709            CDS       T01002                                 

Gene name
Pik3r6, BB220380, p84, p84_PIKAP, p87, p87(PIKAP), p87PIKAP
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 5
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04371  Apelin signaling pathway
mmu04611  Platelet activation
mmu04725  Cholinergic synapse
mmu04921  Oxytocin signaling pathway
mmu05145  Toxoplasmosis
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104709 (Pik3r6)
   04072 Phospholipase D signaling pathway
    104709 (Pik3r6)
   04022 cGMP-PKG signaling pathway
    104709 (Pik3r6)
   04151 PI3K-Akt signaling pathway
    104709 (Pik3r6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104709 (Pik3r6)
   04062 Chemokine signaling pathway
    104709 (Pik3r6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104709 (Pik3r6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104709 (Pik3r6)
  09156 Nervous system
   04725 Cholinergic synapse
    104709 (Pik3r6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    104709 (Pik3r6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104709 (Pik3r6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    104709 (Pik3r6)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    104709 (Pik3r6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 104709
NCBI-ProteinID: NP_001075035
MGI: 2144613
Ensembl: ENSMUSG00000046207
Vega: OTTMUSG00000005945
UniProt: Q3U6Q4
Position
11; 11 B3
AA seq 756 aa
MESSDVELDFQRSVQAVLRELNTPNPALQSNQGMWRWSLHKKVERNPGKSSILVRILLRE
LEKAESEDGRRVIIPLLLTLMSVLTKATGIPEDLYHRAYTFCTRLLTLPAPYSTVALDCA
IRLKTETAVPGTLYQRTVIAEQNLISELYPYQERVFLFVDPELVSASVCSALLLEIQAAQ
EQQTPEACMRHVVSHALQAALGEACHTGALNRKLQASSRRVLEYYFHAVVAAIEQVASED
SPSRLGHLEKMEEIYCSLLGPATTRRHCVGDLLQDRLPSIPLPSPYITFHLWTDQEQLWK
ELVLFLRPRSQLRLSADLDALDLQGFRLDRDLARVSTDSGIERDLPLGSDELPDPSSSEM
ERAALQRKGGIKKRVWPPDFFMPGSWDGPPGLHRRTGRPSGDGELLPGVSRVHTARVLVL
GDDRMLGRLAQAYYRLRKRETKKFCLTPRLSLQLYYIPVLAPQVTGQDPEASRKPELGEL
ASFLGRVDPWYESTVNTLCPAILKLAEMPPYLDTSRTVDPFILDVITYYVRMGTQPIYFQ
LYKVKIFTSLSHDPTEDIFLTELKVKIQDSKSPKEGSSPRRRGAAEGTGAELSMCYQKAL
LSHRPREVTVSLRATGLVLKAIPAGDTEVSGFFHCTSPNAASATDCSCLHVSVTEVVKSS
NLAGRSFTTSTNTFRTSSIQVQSQDQRLLTLWLDKDGRRTFRDVVRFEVSPCPEPCSRTQ
KSKTSALNSHGQETEKNMAKPNSLLMPINTFSGIIQ
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggagagctcagatgtggagctggacttccagaggagtgtacaggctgtgctgcgagag
ctcaacaccccaaacccagccctccagagcaatcagggcatgtggagatggtctctgcac
aagaaggtggagagaaacccaggaaagagctccattctggtccgaattctgctcagagag
ctggagaaggcagaaagcgaggacggacgccgtgtcatcattcccttgctgctcactcta
atgtccgtgctcactaaggccacaggcatcccagaagatctgtaccatagagcttatacc
ttctgcaccaggctactgaccctgccggccccctactctacagtcgccttggactgcgcc
ataagactgaaaacagagacggctgtcccaggtacgctgtaccagaggactgtcatcgct
gagcagaatctgataagtgaactatacccttaccaggagagggtgtttctgttcgtggac
cctgagctggtttctgcctccgtgtgcagtgccctgctgctggagatccaggcggcccaa
gagcagcagacaccggaggcctgcatgcgccacgtggtctcccacgccttgcaggcagct
ctgggagaagcctgccacacaggtgctctgaacaggaagctgcaggccagctcccgacgc
gtcctggaatactatttccacgccgttgtggctgccatagagcaggtggctagcgaggac
agccccagccggctgggacacctggagaagatggaggagatttactgctcgctgctaggg
cctgcgaccacaagaaggcactgtgtcggtgaccttctgcaagaccgcctgccaagcatc
cccctgcccagcccctacatcaccttccacctctggaccgaccaggagcagctctggaag
gaactggtactcttcctccgcccacgctcgcagctgcgcctcagtgctgatctggatgcc
ttggatctacaaggatttaggctagaccgggacttggcccgggtgtccaccgacagtgga
attgagcgggacctccctttggggagcgatgagcttccggaccccagcagctctgagatg
gagcgggccgcccttcaacgcaaggggggcatcaagaagcgtgtgtggccccctgacttc
ttcatgcctggcagctgggatgggcccccggggttgcatcggaggactggcaggcctagt
ggggacggggagctgctacctggagtctctcgggtgcataccgcccgcgtgctcgttctg
ggggatgacaggatgctagggcgcttggcccaggcttactacagactcaggaaacgggag
accaagaagttctgcctcactcctagactcagcctacagctctactatatccctgtgctg
gcgcctcaggtgactggacaggatccagaagcatccaggaagcctgagctgggagagctg
gcttccttcctgggtcgagtcgacccatggtatgaaagcactgtcaacaccctgtgtcct
gccatcctcaagctggccgagatgcctccctacttggacacatctaggaccgtggacccc
ttcatcctggatgtcatcacttactatgtccgcatgggcactcagcccatctatttccag
ctctacaaggttaagatcttcaccagcttgagtcacgaccctacagaggacattttcctc
acagagctgaaggtgaagatccaagactccaagtcccccaaagagggctcttcacctcga
aggagaggggcagctgagggcacaggagctgagctgtccatgtgctaccagaaggccctg
ctcagccacagaccacgagaggtcactgtttctctgcgggccaccgggctggtcctgaag
gccattccagctggtgacactgaagtttcagggttcttccactgtacctcaccaaatgct
gcttctgccacagactgttcctgtctgcacgtcagtgtgacagaggtggtcaagtcctcc
aatctggcaggaaggtcatttacgacatcaaccaacaccttccggacatccagtatccaa
gtccagagccaagaccagaggctgctcacactatggctggacaaggacggacggcggact
ttcagggatgtggtcagatttgaggtcagtccctgcccagagccatgttcacggacccag
aaatccaagacgtcagcgctcaattcgcacgggcaggagacagagaagaacatggccaag
cccaattctcttctgatgcccatcaacacattctctggcatcatccaataa

KEGG   Mus musculus (mouse): 30955
Entry
30955             CDS       T01002                                 

Gene name
Pik3cg, 5830428L06Rik, PI(3)Kg, PI3K<ga, PI3Kg, PI3Kgamma, p110ga, p110gamma, p120-PI3K
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04022  cGMP-PKG signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04371  Apelin signaling pathway
mmu04611  Platelet activation
mmu04725  Cholinergic synapse
mmu04921  Oxytocin signaling pathway
mmu05132  Salmonella infection
mmu05145  Toxoplasmosis
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    30955 (Pik3cg)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    30955 (Pik3cg)
   04072 Phospholipase D signaling pathway
    30955 (Pik3cg)
   04022 cGMP-PKG signaling pathway
    30955 (Pik3cg)
   04151 PI3K-Akt signaling pathway
    30955 (Pik3cg)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    30955 (Pik3cg)
   04062 Chemokine signaling pathway
    30955 (Pik3cg)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    30955 (Pik3cg)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    30955 (Pik3cg)
  09156 Nervous system
   04725 Cholinergic synapse
    30955 (Pik3cg)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    30955 (Pik3cg)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    30955 (Pik3cg)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    30955 (Pik3cg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    30955 (Pik3cg)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     30955 (Pik3cg)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    30955 (Pik3cg)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 30955
NCBI-ProteinID: NP_001139672
MGI: 1353576
Ensembl: ENSMUSG00000020573
Vega: OTTMUSG00000033083
UniProt: Q9JHG7 Q3UVA4 Q8C5Q7
Position
12; 12 A3
AA seq 1102 aa
MELENYEQPVVLREDNLRRRRRMKPRSAAGSLSSMELIPIEFVLPTSQRISKTPETALLH
VAGHGNVEQMKAQVWLRALETSVAAEFYHRLGPDQFLLLYQKKGQWYEIYDRYQVVQTLD
CLHYWKLMHKSPGQIHVVQRHVPSEETLAFQKQLTSLIGYDVTDISNVHDDELEFTRRRL
VTPRMAEVAGRDAKLYAMHPWVTSKPLPDYLSKKIANNCIFIVIHRGTTSQTIKVSADDT
PGTILQSFFTKMAKKKSLMNISESQSEQDFVLRVCGRDEYLVGETPLKNFQWVRQCLKNG
DEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFAEEVLWNVWLEFGIKI
KDLPKGALLNLQIYCCKTPSLSSKASAETPGSESKGKAQLLYYVNLLLIDHRFLLRHGDY
VLHMWQISGKAEEQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHRPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREIWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLQDFTQQVHVIEMLQKVTIDIKSLSAEKYDVSSQVISQLKQKLESLQNSNLP
ESFRVPYDPGLKAGTLVIEKCKVMASKKKPLWLEFKCADPTVLSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAQIQQSTVGNTG
AFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGSSGKKTSPHFQKFQDVCVRAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt   +upstreamnt  +downstreamnt
atggagctggagaactatgaacaaccggtggttctaagagaggacaacctccgccggcgc
cggaggatgaagccacgcagcgcagcaggcagcctgtcttccatggagctcatccccatt
gagttcgtactgcccaccagccagcgcatcagcaagactccagaaacagcgctgctgcat
gtggctggccatggcaatgtggaacagatgaaagctcaggtgtggctgcgcgcactggag
accagtgtggctgcggagttctaccaccgattgggcccggaccaattcctcctgctctac
cagaagaaaggacaatggtatgagatctatgacaggtaccaagtggtgcagaccctagac
tgcctgcattactggaagttgatgcacaagagccctggccagatccacgtggtacagcga
cacgtaccttctgaggagaccttggctttccagaagcagctcacctccctgattggctat
gacgtcactgacatcagcaatgtgcacgatgatgagctagagttcactcgccgccgtctg
gttacgccccgcatggctgaagtggctggccgggatgccaaactctatgctatgcaccct
tgggtaacgtccaaacctctcccagactacctgtcaaaaaagattgccaacaactgcatc
ttcatcgtcatccaccgcggtaccaccagccaaaccatcaaggtctccgcagatgatact
cctggtaccatcctccagagcttcttcaccaagatggccaagaagaagtccctaatgaat
atctcagaaagtcaaagtgagcaggattttgtattgcgggtttgtggccgcgatgagtac
ctggtgggtgaaacacccctcaaaaatttccagtgggtgaggcagtgcctcaagaacgga
gatgaaatacacctggtgctcgacacgcctccagacccagcccttgatgaggtgaggaag
gaagaatggccgctggtggatgactgcactggagtcaccggctaccacgagcagctgacc
atccatggcaaggaccacgagagtgtgttcacagtgtctttgtgggactgcgaccgaaag
ttcagggtcaagatcagaggcattgatatccctgtcctgcctcggaacaccgacctcact
gtgtttgtggaagcgaacatccagcacgggcaacaagtcctctgccaaaggagaaccagc
cctaagcccttcgcagaagaggtactctggaatgtgtggctggagtttggcatcaaaatc
aaagacttgcccaaaggggctctattgaacctacagatctactgctgcaaaaccccatca
ctgtccagcaaggcttctgcagagactccaggctccgagtccaagggcaaagcccagctt
ctctattacgtgaacttgctgttaatagaccaccgtttcctcctccgccacggggactat
gtgctccacatgtggcagatatctggcaaggcagaggagcagggcagcttcaatgctgac
aagctcacatccgcaaccaatcctgacaaggagaactcaatgtccatttccatcctgctg
gacaattactgtcaccccatagctttgcctaagcaccggcccacccctgacccagaggga
gacagggttcgggctgaaatgcccaatcagcttcgaaagcaattggaggcgatcatagcc
acagatccacttaaccccctcacagcagaggacaaagaattgctctggcattttcgatat
gaaagcctgaagcatccgaaggcttaccctaagctattcagctcagtgaaatgggggcag
caagaaattgttgccaaaacgtaccagctgttagccagaagggagatctgggatcaaagt
gctttggacgttggcttaaccatgcagctcctggactgcaacttttcagacgagaatgtc
cgggccattgcagttcagaaactggagagcttagaggacgatgacgttttacattacctt
ctccagctggtacaggctgtgaaatttgaaccgtaccacgacagtgcgctggccagattc
ctgctgaagcgtggcttgaggaacaaaagaatcggtcacttcttgttctggttcctgcga
agtgagatcgcacagtccagacactatcagcagaggttcgctgtgatcctggaggcgtac
ctgcgaggctgtggcacagccatgttgcaggacttcacacagcaggtccatgtgattgag
atgttacagaaagtcaccattgatattaaatcgctctcggcagagaagtatgacgtcagt
tcccaagttatttcacagcttaagcaaaagcttgaaagccttcagaactccaatctcccc
gagagctttagagttccctatgatcctggactaaaagccggtaccctggtgatcgagaaa
tgcaaagtgatggcctccaagaagaagcccctgtggcttgagtttaagtgtgctgatccc
acagtcctatccaacgaaaccattggaatcatctttaaacatggtgatgatctgcgccaa
gacatgttgatcttgcagattctacgcatcatggagtccatttgggagactgaatctctg
gacctgtgccttctgccttacggttgcatctcaactggtgacaaaataggaatgatcgag
attgtaaaggatgccacaacgatcgctcaaattcagcaaagcacagtgggtaacacgggg
gcattcaaagatgaagtcctgaatcactggctcaaggaaaaatgtcctattgaagaaaag
tttcaggccgcagtggaaaggtttgtttactcctgtgcaggctactgtgtggccacattt
gttcttgggatcggtgacaggcacaacgacaacattatgatctcagagacaggaaaccta
tttcatatagacttcggacacattcttgggaattacaagagtttcctgggcatcaataaa
gagagagtgcccttcgtcctaaccccagacttcttgtttgtgatgggatcttctggaaaa
aagacaagtccacacttccagaaattccaggatgtctgtgttagagcttacctagctctt
cgccatcacacaaacctgttgatcatcttgttctccatgatgctgatgacaggaatgccc
cagctgacaagcaaagaggacattgaatatatccgggatgccctcaccgtgggaaaaagc
gaggaggacgctaagaaatatttccttgatcagatcgaagtctgcagagacaaaggatgg
actgtgcagtttaactggttcctacatcttgttcttggcatcaaacaaggagaaaagcac
tccgcttga

KEGG   Mus musculus (mouse): 320207
Entry
320207            CDS       T01002                                 

Gene name
Pik3r5, AV230647, F730038I15Rik, Fo, Foap2, p10, p101
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 5
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04371  Apelin signaling pathway
mmu04611  Platelet activation
mmu04725  Cholinergic synapse
mmu04921  Oxytocin signaling pathway
mmu05145  Toxoplasmosis
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    320207 (Pik3r5)
   04072 Phospholipase D signaling pathway
    320207 (Pik3r5)
   04022 cGMP-PKG signaling pathway
    320207 (Pik3r5)
   04151 PI3K-Akt signaling pathway
    320207 (Pik3r5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    320207 (Pik3r5)
   04062 Chemokine signaling pathway
    320207 (Pik3r5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    320207 (Pik3r5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    320207 (Pik3r5)
  09156 Nervous system
   04725 Cholinergic synapse
    320207 (Pik3r5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    320207 (Pik3r5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    320207 (Pik3r5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    320207 (Pik3r5)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    320207 (Pik3r5)
SSDB
Motif
Pfam: PI3K_1B_p101 DUF2284
Other DBs
NCBI-GeneID: 320207
NCBI-ProteinID: NP_796294
MGI: 2443588
Ensembl: ENSMUSG00000020901
Vega: OTTMUSG00000005944
UniProt: Q5SW28 A1A4T4
Position
11; 11 B3
AA seq 871 aa
MQPAATTCTEDRIQHALERCLHGLSLGRRSAPWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTQEVQEKGTYDLLAPLALLFYSTVLCTPHFPPDSDLLLKAASTYHCFLTWPVPYC
SICREMLTFIDAELKAPGISYQRLVRAEQGLPVRSHRSSTVTVLLLNPVEVQAEFLAVAD
KLSTPGQSPHGTYTTLLLHAFQATFGAHCDLPKLHRKLQSKTIEELEDIFTETTEAQELA
SGIGDVAEAREWLRTKLQAVGEKAGFPGILDTASPGKLHTIPIPVARCYTYSWNQDSFDI
LQEVLLKEQELLQPGILGDDEEEEEEDLEMDRHCAERDSLLSTSSLVSHDSTLLLTSSQA
SEPVLSRQMLTTFVSGLSDGMDSGYVEDSEENSEWPQKPGSQKRQGHRRPGQKFNRFYKL
LKSTSQLVLRRDSRSLESSVDPTLPLRRAGSLCSPLDCPAQLPSRAQRSRSLPQAKLTTQ
LPRWLLAPPSHHQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSKLRRLETSHPI
LTRFFKLQFFYVPVKRSHGTSPSACPSSLSQASPLPADSLKYPSPTDLGMAPWEDSTNDI
SHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKADSRPLEGSATQLPILADMLLYYCRFAA
RPVLLQVYQTELTFVTGEKTTEIFIQSLELGHSATTRAIKASGRGRKRLGIDDDREAVPL
TLQIIYSKGAISGRSRWSNLEKVCTSVNLSKACQKPEELDSSMEALTLTLTEVVKRQNPK
SKKGFNQISTSYIKVDKVQIIGSSSCPFAVCLDQDERKILQSVVRCEVSPCYKPEKSSLP
PERSFSQPAETGSDLCSLLCLPIMTFSGALP
NT seq 2616 nt   +upstreamnt  +downstreamnt
atgcagccagcagccacaacgtgcacagaggaccgcatccagcatgctctggagcgatgc
ttgcatggactgagcctcggacgccgttctgctccctggtcagccgggctgtgtctgaac
tgctggagcctacaggagctggtcagcagggacccgggccacttcctcatcctcctggaa
cagatcctacaaaagacccaagaggtccaagagaaaggcacctatgacctcctcgccccg
ctggctctgctcttctattccactgtcctctgtacaccacacttcccaccagactccgac
ctcctgctgaaggcagccagcacctaccactgcttcctgacctggccagttccctactgc
agcatctgcagagagatgctcaccttcattgatgctgaactcaaggccccaggaatctcc
taccagcggctggtgagggctgagcagggcctgcccgtcaggagccaccgaagttccact
gtcactgtgctgttgctgaacccggtagaggtacaggctgaattccttgctgtggcagac
aagctgagcacgcctggacagtcaccccacggcacctacaccaccctgctcctgcatgcc
ttccaggccacctttggggcccactgcgaccttcctaaactacaccgcaaacttcagtcc
aagacaatagaagagctggaggacatcttcaccgagacgacagaagcccaggagctggcg
tctggcattggggatgtagcagaggcccgagagtggctccggaccaagctgcaggcagtg
ggagaaaaagcgggcttccctggcatcttagacactgcaagccctgggaaactccacacc
atccccatccctgtcgccagatgctacacctacagctggaaccaggacagctttgacatc
ctacaggaagtccttctcaaggaacaggagctgctgcagccagggatcttgggagatgat
gaagaggaggaagaggaggacttggagatggacaggcattgcgctgagagggactctctc
ctctccaccagctccctggtgtctcacgactccacactgttgctcacctcctctcaggcc
tcagaaccggtgctgtcccgccagatgctgaccacctttgtctcaggcctctcggatggc
atggacagtggctacgtggaggacagcgaggaaaactcagagtggccccaaaagcccggc
agccagaaacgccagggtcatcgcaggcctgggcagaagttcaacaggttctataaactc
ttaaagagcaccagccagttagtcctgaggagggactctcggagcctggagagcagtgta
gacccaaccctgcctctgcgaagggctgggagcctctgcagccccttggactgtcccgct
cagctcccctcccgggctcagcgctcacggtccttgcctcaggccaagctcaccacccaa
ctccccagatggcttctggcaccaccctcacaccaccagcgccgccgtcccttcctcagt
ggggatgaggaccccaaagcttccacactacgggttgtggtctttggctctgatcggatt
tcagggaaggtggctagggcctatagcaagctcaggaggctggagaccagtcaccctatc
ctcacacgcttcttcaagcttcagttcttctatgtgcctgtgaagagaagccacggaacc
agccccagtgcctgcccatcctctctgagccaagcatctccactccctgcagactccctg
aagtaccccagccctacagaccttggcatggccccatgggaggacagtaccaatgacatc
tctcactacctcggtatgcttgacccctggtacgaacgcaatgtgttgggcctcatgcac
ctgcctcctgaagtcctttgtcagcagtccctgaaggcagactctcggcccctggaggga
tcggccacccagctgcccatcctggccgatatgttactctactactgccgctttgcggcc
cgccccgtgttgctgcaggtttaccagacagagctgacctttgtcaccggggagaagacc
acagagatcttcatccagtctctggagctgggtcactctgcgaccactcgggctatcaag
gcttcaggtcggggtaggaagaggctgggcattgatgacgaccgggaggccgtccctcta
acactacagattatttacagcaagggagccatcagtgggcgaagccgctggagcaacctg
gagaaggtctgcacctctgttaacctcagcaaggcctgccagaagccggaggagctagac
tccagcatggaggcgctaacgctaaccctgacagaagtggtgaagaggcagaaccctaaa
tccaaaaagggctttaaccagatcagtacatcctacatcaaagtggacaaggtgcagatc
atcggctctagcagctgcccctttgccgtgtgtctagaccaggatgagagaaagatcctg
cagagtgtggtcaggtgtgaagtgtcaccctgctacaagccagagaagagcagcttgcca
cccgagaggtccttcagccagccagcagagactgggtccgacctgtgctcccttctctgc
cttcccatcatgacattcagtggggctctgccctag

DBGET integrated database retrieval system