KEGG   Mus musculus (house mouse): 104725
Entry
104725            CDS       T01002                                 
Symbol
Sptssa, 1110002B05Rik, AA407909, AA409588, AU041967, Ssspta
Name
(RefSeq) serine palmitoyltransferase, small subunit A
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: SPT_ssu-like
Other DBs
NCBI-GeneID: 104725
NCBI-ProteinID: NP_598815
MGI: 1913399
Ensembl: ENSMUSG00000044408
UniProt: Q8R207
Position
12:complement(54692159..54703357)
AA seq 71 aa
MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSVVGMALYTGYVFMPQHI
MAILHYFEIVQ
NT seq 216 nt   +upstreamnt  +downstreamnt
atggcgggcatggcgctggcgcgagcatggaagcagatgtcctggttctactaccagtac
ctgctggtcactgcgctctacatgctggagccctgggagcgaaccgtgttcaattcgatg
ctggtttccgtggtggggatggccctgtacactggctacgtcttcatgccccagcacatc
atggctattctgcattactttgaaattgtacagtga

DBGET integrated database retrieval system