KEGG   Mus musculus (mouse): 104771Help
Entry
104771            CDS       T01002                                 

Gene name
Jkamp, 1200003C05Rik, 2310047L11Rik, Jamp
Definition
(RefSeq) JNK1/MAPK8-associated membrane protein
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: JAMP
Motif
Other DBs
NCBI-GeneID: 104771
NCBI-ProteinID: NP_077167
MGI: 1915057
Ensembl: ENSMUSG00000005078
Vega: OTTMUSG00000027642
UniProt: Q8BI36
Position
12; 12 C3
AA seq 311 aa AA seqDB search
MAVDIQPACLGLYCGKTLLFKNGSSEIYGECGVCPRGQRTNAQKYCQPCTESPELYDWLY
LGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECTMAAIITLLVSDPVGVLYIRSC
RVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFVYYAFCLVLMMLLRPLLVKKIA
CGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIEN
CYDLLVRKKRLIVLFSHWLLHAYGIVSISRVDRLEHDLPLLALVPTPALFYLFTAKFTEP
SRILSEGANGH
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgatattcaaccagcatgccttggactctactgtgggaagaccctattattt
aaaaatggctcaagtgaaatctatggagaatgtggggtatgcccaagaggacagaggacc
aatgcacagaagtactgtcagccttgcacagagtccccagaactttacgactggctctat
ctgggctttatggctatgcttcctcttgttctgcattggttcttcattgaatggtactcg
gggaaaaagagctccagtgctcttttccagcacatcaccgcgctctttgaatgcaccatg
gcagctatcatcaccttactcgtgagtgatcccgtgggcgtcctttacatccgttcctgc
cgcgttctgatgctttctgattggtacacgatgctctacaacccaagtccagattacgtc
accacggtgcactgcactcacgaagccgtctacccactgtacaccatcgtgttcgtttat
tacgcgttctgcttggtgttaatgatgcttctgcggcctctcctggtgaagaagatcgca
tgcggactcggcaagtctgaccgcttcaaaagtatttacgcagctctttacttcttcccc
atcctgaccgtgctgcaggcggtcggtgggggcctcttatattacgccttcccgtacatt
atattagtgttatctctggttaccctggctgtatacatgtctgcttctgaaatagagaac
tgctatgatctcctggtcaggaagaaaagacttatcgttctcttcagccactggctactg
cacgcctatggcatagtctccatctccagagtggacaggctggaacacgacctaccgctt
ttggctttggtacctacaccagctctgttttacttgtttactgcaaaatttaccgaacca
tcacggatactctcagaaggggccaatggacattga

DBGET integrated database retrieval system