KEGG   Mus musculus (mouse): 104816
Entry
104816            CDS       T01002                                 

Gene name
Aspg, A530050D06Rik, AI429460, Gm690
Definition
(RefSeq) asparaginase
  KO
K13278  60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104816 (Aspg)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     104816 (Aspg)
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     104816 (Aspg)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     104816 (Aspg)
SSDB
Motif
Pfam: Asparaginase Asparaginase_C Ank_2 Ank_5 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 104816
NCBI-ProteinID: NP_001074638
MGI: 2144822
Ensembl: ENSMUSG00000037686
UniProt: A0JNU3
Position
12; 12 F1
AA seq 564 aa
MARAMGPERRLLAIYTGGTIGMRSEGGVLVPGRGLAAVLKTLHMFHDEEYAQAHSLPEDT
LVLPPASPDQRIIYTVLECQPLFDSSDMTITEWVQIAQTIERHYAQYQGFVVIHGTDTMA
FAASVLSFMLENLQKPVVLTGAQVPIHALWSDGRENLLGALLMAGQYVIPEVCLFFQNQL
FRGNRTTKVDARRFAAFCSPNLPPLATVGADVTINRELVRKACGKSHLVVHSSMEPDVGL
LRLYPGIPASLVRTFLQPPLKGVVMETFGSGNGPTKPDLLQELRVAAEQGLIIVNCTHCL
QGAVTSDYASGMAMAGAGIVSGFDMTSEAALAKLSYVLGQPGLSLNDRKKLLAKDLRGEM
TLPATDVLLQDGMLGCRVAWLLSMNGSQEADTMKDVLLPGLALAAAHAGDLDTLQAFVEL
DRDLNLKDYSGQTPLHVAARRGHAAVVTMLLQRGADVDARNEDGQSPLLLAVRGRHQSVI
GLLRAAGARLSPQELEDVGTELCRLASRGDSEGLRAWWQAGADLGQPDYDGHCALQVAEA
AGNADVVALLQSFKDSVCAQPQPH
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggcgcgtgctatgggaccagagcggcggctgctggccatttacactggcggcaccatc
ggcatgcggagcgaaggcggagtgttggtacctggcagaggcctggctgccgtcctgaag
acacttcacatgttccacgatgaagagtatgcacaggcccacagcctgcccgaggatacg
ctggtgctgcccccggccagccctgaccagaggatcatctacacggtgctggagtgccag
ccactcttcgactccagtgacatgaccatcactgagtgggttcagattgcccaaaccata
gagagacactacgcacagtaccagggctttgttgtcatccatggcacagacaccatggcc
tttgctgcctcagtgctctctttcatgctggaaaatctgcagaaaccagtcgtcctcacg
ggtgcccaggtacctatccacgcactgtggagtgacggccgtgagaacctgctgggggct
ctgctcatggctggccaatacgtcatccctgaggtctgcctgttcttccagaatcagctc
ttccggggcaatcggacaaccaaggtggacgctcggaggtttgccgccttctgctcccct
aacctgccccctctagccactgtgggcgcggatgtcacaatcaaccgtgagctggtacgg
aaggcctgcgggaagagccatctggtggtccacagtagcatggagcctgacgtgggccta
ctgcgcctctaccctggaattcccgcctccctggtccggaccttcctccagcccccactg
aaaggcgtggtcatggagaccttcggctctgggaatgggcccaccaagccagacctacta
caggagcttcgggtggcggccgaacaaggcctgatcattgtcaactgtacccattgcctt
cagggggctgtgacttcggactatgcatctggcatggccatggcaggagctggcatagtc
tcgggcttcgacatgacatcagaggctgccctggccaaactgtcctatgtgctgggccag
ccagggctgagcctgaatgacaggaagaagctgctggccaaggatcttcgtggggagatg
acgctgcctgcaacagatgtcttgctgcaggatggcatgctgggctgcagggtagcttgg
cttctcagtatgaatggcagccaggaggctgataccatgaaggatgttcttctgcccggc
ctggccctggctgcagctcacgctggtgacctggacaccctgcaggcctttgtggaactg
gacagagacctaaacctgaaggactatagtggtcaaaccccactgcatgtggctgcacgg
aggggccatgccgcagtggttaccatgctgctgcagaggggtgcggatgtggatgcccgt
aatgaggatggtcagagcccactattgctggccgtgaggggcaggcatcagagtgtcatt
gggctgctgagagctgctggggcccgcctgtctccccaggagctggaggacgttgggaca
gagctgtgcaggctggcatcaaggggagacagcgaaggcctgcgggcatggtggcaggct
ggggctgacctgggacagccagactatgatggacactgtgccctgcaagtagctgaagca
gctggaaatgcagatgtggtggccctgctacagagctttaaggacagtgtctgtgcccag
ccccagccccactag

DBGET integrated database retrieval system