KEGG   Mus musculus (house mouse): 104831
Entry
104831            CDS       T01002                                 
Symbol
Ptpn23, PTP-TD14
Name
(RefSeq) protein tyrosine phosphatase, non-receptor type 23
  KO
K18040  tyrosine-protein phosphatase non-receptor type 23 [EC:3.1.3.48]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    104831 (Ptpn23)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    104831 (Ptpn23)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     104831 (Ptpn23)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    104831 (Ptpn23)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   104831 (Ptpn23)
SSDB
Motif
Pfam: BRO1 Y_phosphatase ALIX_LYPXL_bnd Y_phosphatase3 DSPc PTPlike_phytase
Other DBs
NCBI-GeneID: 104831
NCBI-ProteinID: NP_001074512
MGI: 2144837
Ensembl: ENSMUSG00000036057
UniProt: Q6PB44
Structure
Position
9:complement(110214152..110237278)
AA seq 1692 aa
MEAVPRMPMIWLDLKEAGDFHFQSAVKKFVLKNYGENPEAYNEELKKLELLRQNAIRVAR
DFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVAVTWTEIFSGKSVSHEDIKYEQACILYN
LGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAFSVDMSRQILTLNVNL
MLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKL
VQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRF
AMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKL
VPMAAHEASSLYSEEKAKLLREMLAKIEDKNEVLDQFMDSMQLDPETVDNLDAYNHIPPQ
LMEKCAALSVRPDTVKNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELQEQKLQETLGQA
GAGPGPSVAKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGNLRLLSGPLDQVRA
ALPTPALTPEDKAVLQNLKRILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDHSEM
KKLFEEQLKKYDQLKVYLEQNLAAQDNVLRALTEANVQYAAVRRVLSELDQKWNSTLQTL
VASYEAYEDLMKKSQEGKDFYADLESKVATLLERAQSICRAQEAARQQLLDRELKKKAPP
PRPTAPKPLLSRREEGEAVEAGDTPEELRSLPPDMMVGPRLPDPFLGTTAPLHFSPGPFP
SSTGPATHYLSGPLPPGTYSGPTQLMQPRAAVPMAPATVLYPAPAYTSELGLVPRSSPQH
GIVSSPYAGVGPPQPVVGLPSAPPPQLSGPELAMTVRPATTTVDSVQAPISSHTAPRPNP
TPALPQPCFPVPQPVPQSVPQPQPLPVPYTYSIGTKQPLPAPYTYSIGTKQHLTGPLPQH
QFPPGIPTGFPVPRTGPQAQAQPQPQPQPQPQPQPQPQPQPQPQSQSQPQPQPQPQPQRP
AFGPQPTQQPLPFQHPHLFPSQAPGILPPPPPTPYHFTPQPGVLGQPPPTLHTQLYPGPS
QDPLPPHSGALPFPSPGPPHPHPTLAYGPAPSPRPLGPQATPVSIRGPPPASQPTPSPHL
VPSPAPSPGPGPVPSRPPTAEPPPCLRRGAAAADLLSSSPESQHGGTQPPGGGQPLLQPT
KVDAAEGRRPQALRLIEQDPYEHPERLQQLQQELEAFRGQLGDAGALDAIWRELQEAQEH
DARGRSIAIARCYSLKNRHQDVMPYDSNRVVLRSGKDDYINASCVEGLSPYCPPLVATQA
PLPGTAADFWLMVHEQKVSVIVMLVSEAEMEKQKVARYFPTERGQPMVHGALSVALSSIR
TTETHVERVLSLQFRDQSLKRSLVHLHFPTWPELGLPDSPGNLLRFIQEVHAHYLHQRPL
HTPIVVHCSSGVGRTGAFALLYAAVQEVEAGNGIPELPQLVRRMRQQRKHMLQEKLHLKF
CHEALVRHVEQVLQRHGVPPPGKPVASVNISQKNHLPQDSQDLVLGGDVPISSIQATIAK
LSIRPLGGLDSPAASLPGLVEPPGLPPASLPESTPVPSSSPPPLSSPLPEAPQPEEEPSV
PEAPSLGPPSSSLELLASLTPEAFSLDSSLRGKQRMSKQNFLQAHNGQGLRAAQPTDDPL
SLLDPLWTLNKT
NT seq 5079 nt   +upstreamnt  +downstreamnt
atggaggccgtgccccggatgcccatgatctggctggacctgaaggaggccggtgacttt
cacttccagtctgcggtgaagaagtttgtcctgaagaattatggagagaacccagaagcc
tacaacgaggaactaaagaagctggaattactcagacagaatgctattcgcgttgcccgg
gactttgagggctgcagtgttcttcgaaagtaccttggccagctacactacctacagagt
cgggtgcccatgggctcaggccaggaggctgctgtagctgtcacctggactgagatcttc
tcgggcaagtctgtgtcccatgaagacatcaagtacgagcaggcctgtattctctacaac
ctcggtgcactgcactccatgctgggggctatggacaagcgggtgtctgaggagggcatg
aaagtctcctgcacccacttccagtgtgcagcaggcgcctttgcctacctgcgtgaacac
ttcccacaggccttcagtgtggacatgagtcgccagatccttacgctcaatgtcaacctc
atgctgggccaggctcaggagtgcctgttggagaagtccatgttggacaaccggaagagc
tttctagtggcccgcatcagcgcacaggtggtagattactataaggaggcatgccgggcc
ttggaaaaccctgatactgcctccctgctgggccgtatccagaaagactggaagaaactt
gtccaaatgaagatctactactttgcggctgtggctcatctacacatggggaagcaggct
gaggagcaacagaaatttggggaacgggtggcctacttccagagtgccctggacaagctt
aatgaagccatcaagttggccaagggccagcccgacactgtgcaagatgcacttcgcttt
gctatggatgtcatcgggggcaaatataattctgccaagaaggacaatgactttatctac
catgaggctgtgccagcactggatacactccagcctgtgaaaggagctcccttggtgaag
cccttgccagtaaaccccacagacccagctgttacaggtcctgacatctttgccaagttg
gtgcccatggctgcccatgaggcctcatcactgtacagtgaggagaaggccaaactgctt
cgggagatgctggccaaaattgaagataagaatgaggtcctagatcagttcatggactcc
atgcagctggaccctgagacagtggacaacttggatgcctacaaccatatccccccccag
ctcatggagaagtgtgcggcactcagcgtccggcctgacactgtcaagaaccttgtccag
tctatgcaggtgctgtcaggggtgttcacggatgtggaggcctccctgaaggacatcagg
gatctactggaggaagatgagctgcaagagcagaaattgcaggagaccctgggccaggcc
ggggctggccctggcccctctgttgccaaggctgagcttgcagaggtgaggcgagaatgg
gccaagtacatggaagtgcatgaaaaggcttccttcaccaacagtgagctgcatcgtgct
atgaacctgcatgttggtaacttgcgcctgctcagtggaccactggaccaggtgcgggct
gccctacccacaccagccctcaccccagaggacaaagccgtgctgcaaaacctaaagcgc
atcctcgccaaggtgcaggagatgcgggaccagcgtgtgtccttggaacagcagctccga
gagctgatccagaaggatgacatcactgcctctctggtcaccactgaccactcagagatg
aagaaactgtttgaggagcagctgaagaagtatgaccagctgaaggtctacctggagcag
aacctggccgcccaggacaatgtcctccgtgccctgactgaggccaacgtgcagtatgca
gccgtgcggcgggtgcttagtgagctggaccaaaagtggaactccacactacagaccctg
gtagcatcctatgaggcctatgaggacctgatgaagaagtcccaagaaggcaaggacttt
tatgcagacttggaaagcaaggtagctacccttctggaacgggcacaatccatctgtcgt
gcccaagaggccgctcgccagcagctcctggacagagagctgaagaagaaggcaccacca
cctcggcctacagccccaaagccattgctgtcccgccgtgaggagggggaggcagtggag
gctggagacacacctgaggagctgcgcagcttgccccctgacatgatggttggcccacgg
ctacctgacccattcctaggaactactgcccctctccacttttctcctggccccttccct
agttccacaggcccagcaacccactatctctcaggacccttaccccctggaacttattca
ggccccactcaactgatgcagcctagggctgcagttcccatggcacctgcaacggtcctc
tacccagcccctgcctatacatcggagttgggcctcgtacccagatcctctccccagcat
ggaattgtaagcagtccctatgcaggggtagggccaccccaaccagttgtaggtcttccc
tctgctccacctccccagctctcaggacccgagttagccatgacagttcggccagctacc
accacagtagatagtgtccaagcccctatctctagccacacggcaccacggccaaaccct
acccctgctcttccccagccctgctttccagtgcctcagcctgtacctcaatctgttccc
caaccacagcctctgcctgtaccctatacttattctatagggaccaagcagcctctgcct
gcaccctatacttactctatagggaccaagcagcacctcactggccctctaccacagcat
cagtttcctcctgggatccccacaggctttccagtccccaggactgggccccaggcccag
gcccagccccaaccccagccccagccccagcctcagcctcagccccagccccagccccag
ccccagccccagtcccagtcccagccccagccccagccccagcctcagccccaacggcca
gcatttgggccacaacccacacaacagccccttccattccagcatccacatctcttccca
tctcaggccccagggattcttccaccaccaccaccaacaccctaccattttactcctcag
cctggtgtcttgggacaaccaccacccaccctacacacccagctctatccaggcccatct
caagaccctcttcccccacattcaggggctctgcctttccccagccctgggccccctcat
cctcaccccaccctggcatatggccctgccccttcccctaggccccttggtcctcaggca
acccctgtctccattcgaggccccccaccagccagtcagcccacccctagtccacacttg
gtgccttcacctgccccatcaccagggcctggcccagtaccttcaagacctccaacagcc
gagccaccaccttgtttgcgccgaggtgctgcagctgcagaccttctgtcttctagccct
gagagccagcatggaggtacccagcctcctgggggtgggcagcccttgctacagcctacc
aaggtagatgcagctgagggccgtcggccacaggccctgcggctaattgagcaggacccc
tatgaacatcccgagaggctgcagcagttgcagcaggagctggaggcctttcggggccag
ctgggggatgcaggagcactggatgccatctggagagagttgcaagaggcacaggaacac
gatgcccgaggtcgatccattgccattgcccgctgctactccctgaagaaccggcaccag
gatgtcatgccgtatgacagcaaccgtgtggtgctgcgctcaggcaaagatgattatatt
aatgctagctgtgtggaggggctctcgccatactgtccacccttagtggccacccaggct
ccgctgcctggcacagctgcagatttctggctcatggtgcatgaacagaaagtgtcagtc
attgtcatgctggtgtctgaggctgagatggaaaagcaaaaggtggcgcgttacttcccc
acagagaggggccagcccatggtgcatggagccctgagcgtggcactgagcagtattcgt
actactgagacccatgtggagcgagtgctgagtctgcagttccgggatcagagcctcaag
cgctctcttgtgcacctccatttccctacttggcctgagttaggcctgccagacagccct
ggcaatctgctgcgcttcatccaggaggtgcatgcacattatttgcaccagcgacccctg
cacacacctattgtcgtacactgcagctctggggtgggccgcacaggagccttcgcgttg
ctctatgcagccgtgcaggaggtggaggctgggaatgggattccagagctgccccagctg
gtgaggcggatgcggcagcagaggaaacacatgctgcaggaaaaacttcacctcaagttc
tgccatgaggcgttggtgagacatgtggagcaggtcctacagcgccatggtgtgcctcct
cctggcaagcctgtggccagtgtgaacatcagccagaagaaccaccttcctcaggactcc
caggatctggtccttggtggagacgtgcccatcagctccattcaggctaccattgccaag
ctcagcatccggcccctaggtggcttggattccccagctgccagcctcccaggccttgta
gaacccccaggtcttccaccagctagccttccagagtctacccctgtcccatcttcctcg
cctcccccactctcttcacctctgcctgaagccccccagccagaggaggagccgtcagtg
cctgaagcccccagcttagggcccccctcgtcatccctggagctgttggcctctctgact
ccagaagcattttcactggacagttctttacggggaaagcagcggatgagcaagcagaac
tttctgcaggcccacaacgggcagggtctaagggctgcccagcctacggatgaccccctc
agcctcctggatccactctggacactcaacaagacctga

DBGET integrated database retrieval system