KEGG   Mus musculus (mouse): 104836
Entry
104836            CDS       T01002                                 

Gene name
Cbll1, AI467391, Hakai, c-Cbl-like
Definition
(RefSeq) Casitas B-lineage lymphoma-like 1
  KO
K15685  E3 ubiquitin-protein ligase Hakai [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    104836 (Cbll1)
   04131 Membrane trafficking [BR:mmu04131]
    104836 (Cbll1)
   04121 Ubiquitin system [BR:mmu04121]
    104836 (Cbll1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     104836 (Cbll1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     104836 (Cbll1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    104836 (Cbll1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    104836 (Cbll1)
SSDB
Motif
Pfam: zf_Hakai zf-C3HC4_3 zf-C3HC4 zf-RING_5 zf-C3HC4_2 zf-RING_UBOX zinc-ribbons_6 zf-RING_2 DZR zf-MIZ
Other DBs
NCBI-GeneID: 104836
NCBI-ProteinID: NP_001240776
MGI: 2144842
Ensembl: ENSMUSG00000020659
Vega: OTTMUSG00000046950
UniProt: Q9JIY2
Structure
PDB: 
3VK6 2MQ1

Position
12; 12 A2
AA seq 491 aa
MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQASKVKPAPRTQRTVSRMPAKAPQGDE
EGFDYNEEQRYDCKGGELFGNQRRFPGHLFWDFKINILGEKDDTPVHFCDKCGLPIKVYG
RMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFMCSIVQGCKRTYLSQR
DLQAHINHRHMRAGKPVTRASLENVHPPIAPPPTDIPDRFIMPPDKHHMSHIPPKQHIMM
PPPPLQHVPHEHYNQPHEDIRAPPAELSMAPPPPRSVSQETFRISTRKHSNLITVPIQDD
SSSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMPHPPQ
AAGTPHLVYSQAPPPPMTSAPPPITPPPGHIIAQMPPYMNHPPPGPPPPQHGGPPVTAPP
PHHYNPNSLPQFTEDQGTLSPPFTQPGGMSPGIWPAPRGPPPPPRMQGPPSQTPLPGPHH
PDQTRYRPYYQ
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggatcacactgacaatgagttacaaggcactaatagttctggatccttgggtggtctt
gatgttcgcagaagaatccctataaagctcatctccaaacaagccagcaaagttaagccg
gcacctcggactcaaaggactgtcagcaggatgcccgcaaaggccccgcaaggtgatgaa
gaaggatttgattataacgaagaacagcgatatgactgtaaaggaggcgaactctttggg
aatcagcgaagatttccaggacaccttttttgggatttcaagataaacatcttaggtgaa
aaggacgatacaccagtacatttctgtgacaaatgtggactgcctattaaagtctatggg
agaatgattccatgcaagcatgtcttttgctatgactgtgctattttacatgaaaaaaaa
ggagataagatgtgcccaggatgtagtgatcctgtgcagcggattgagcagtgcacacga
ggttctctctttatgtgtagcattgttcaaggatgcaagagaacatatctgtctcagaga
gacttacaagctcatatcaaccatcgccatatgagagctggaaagcccgttacccgtgct
tcacttgagaatgttcatcctcctattgcccccccaccaactgacatccccgatcggttc
ataatgccaccagacaagcatcatatgagccatattcctccaaagcagcacatcatgatg
ccaccgcctcctctgcagcatgtgccacatgagcactataatcagccacatgaggatatt
cgtgctcctccggcagaattgtccatggctccacctccacctcgttcggtcagtcaggaa
acctttcgtatttcaacaagaaaacacagcaatttaataacggtccctattcaggatgac
tccagttcaggtgctagagaaccaccacctcctgccccagcacctgctcatcaccatcct
gaatatcagggtcagcccgtggtatctcaccctcatcatattatgcctccacagcaacat
tacgcaccacccccacctcctccaccaccaataagccatccaatgccacaccctccccag
gctgcaggtactcctcacttggtatatagccaagctccacctccaccaatgacctctgct
ccacccccaataacccctccccctggacatattattgcccagatgccaccttatatgaat
catcctcctccaggaccccctccacctcagcatggtggtccacctgtaactgcaccccct
cctcaccattacaatcctaactctttaccccagtttactgaagaccaaggaactctgagc
cctccatttacacaaccaggaggaatgagtcctggtatatggcctgcaccaagagggcca
cctcctcctccacgaatgcagggcccgccttctcaaaccccactacctggaccgcatcat
ccagatcaaacaagatacagaccgtattaccagtga

DBGET integrated database retrieval system