KEGG   Mus musculus (house mouse): 104884
Entry
104884            CDS       T01002                                 
Symbol
Tdp1, 2810481F14Rik, 4921509N21Rik, AI838772, AW493413, E430034L06Rik, Gm40556, MLZ-501, SCAN1
Name
(RefSeq) tyrosyl-DNA phosphodiesterase 1
  KO
K10862  tyrosyl-DNA phosphodiesterase 1 [EC:3.1.4.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    104884 (Tdp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.-
     104884 (Tdp1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     104884 (Tdp1)
SSDB
Motif
Pfam: Tyr-DNA_phospho
Other DBs
NCBI-GeneID: 104884
NCBI-ProteinID: NP_001366001
MGI: 1920036
Ensembl: ENSMUSG00000021177
Position
12:99850767..99921482
AA seq 668 aa
MSQESSYGKWTISSSDESEDEKPKPDKPSASSHPQAGQGVSKELIYTCSEARKVAHKRQI
SPVKFNDADSVLPHKKQKSDSPEGLGWCLSSSDDDQQPDVTQQEQPKRVLPQEKKHVSSP
DVTTAQKVVDRSPPASLRPQRADDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGIKAKYN
SKALHIKDILSPLFGTLVSSAQFNYCFDVDWLIKQYPPEFRKNPILLVHGDKREAKADLH
AQAKPYANISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIREDWHQKTQGIWLS
PLYPRIDQGSHTAGESSTRFKADLTSYLTAYNAPPLQEWIDIIQEHDLSETNVYLIGSTP
GRFQGSHRDNWGHFRLRKLLQAHAPSTPKGECWPIVGQFSSIGSLGPDESKWLCSEFKDS
LLALREEGRPPGKSAVPLHLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQRWLHSYFHK
WSAETSGRSNAMPHIKTYMRPSPDFSKLAWFLVTSANLSKAAWGALEKNGTQLMIRSYEL
GVLFLPSAFSSPVLLHPRGFQDGTAGRYLQLLLFPTGHSGRSMPAVLHQPLLPSLGLLSS
GFAPRSRLQASLLPAARWSLLITVQPPGVPPFSLQPVTPDHQATHTPSLPTPLQFFYIYF
IILYVMFP
NT seq 2007 nt   +upstreamnt  +downstreamnt
atgtcccaagaaagcagctacgggaagtggacaatatccagtagtgacgaaagcgaggat
gagaagcccaaacctgataagccgtcagcatcctctcacccccaggctgggcagggagtg
tcgaaggagctcatatacacctgctcagaggcccgcaaggttgcacacaagagacagatc
tcacctgtgaagttcaacgacgcagactcggtgctaccccacaagaagcagaagagtgac
tccccggaaggtctcggctggtgtctctccagcagcgatgatgaccagcagccagatgtg
acacagcaggaacagcctaagagagtgctgcctcaagagaaaaaacatgtctcctcaccc
gatgtgactactgcccagaaagttgtggatagaagccctcctgccagccttaggccccaa
agggcagacgatgagtacgagacctcaggggaaggccaggacatctgggacatgctggat
aaggggaaccccttccagttttatctcactagagtgtcggggattaaggcaaagtacaac
tccaaagccctccacatcaaggatattttatcccctctgtttgggacacttgtctcttca
gctcagtttaactactgctttgacgtggactggctcataaagcaatatccaccggaattc
aggaagaacccgatcctgcttgtgcacggtgataagagggaagccaaggcagacttacat
gcccaggcgaagccctatgcgaacatttccctctgccaggcaaagttggatattgcattt
ggaacacaccacacgaaaatgatgctcttgctctatgaagaaggcctccgagttgtcatc
cacacctccaacctcatccgggaagactggcaccagaaaacccaaggaatatggttgagc
cctttgtacccaagaattgaccagggaagccacacagctggagagtcaagcacccgtttc
aaagctgacctcaccagttatctaacggcgtataacgctccccctctgcaggagtggata
gacatcatccaagagcatgacctctctgagaccaatgtttacctcattggttcaacccct
ggacgctttcaaggaagtcacagagataactggggacattttaggcttagaaagcttctg
caagcgcatgccccgtccacacccaagggcgagtgctggcctatcgtgggtcagttctca
agcatcggctccctggggcccgatgaatccaagtggctgtgctcggagtttaaagacagc
ttgctggcactgagagaggaaggccgacctccgggcaagagtgcagttcctcttcatctg
atctatccctctgtggaaaatgtgcggaccagcttagaaggataccctgctgggggctct
cttccctatagcatccagacggctgaaaagcagaggtggctgcactcctacttccacaag
tggtcagcagagacatccggccgaagtaatgccatgccacacattaagacgtacatgagg
ccctcgccagacttcagtaaactggcttggttcctggtcacaagtgcgaatctgtccaag
gctgcctggggggcactggagaagaacggcacccagctgatgatacgctcctacgagctc
ggggtcctcttcctcccgtctgcgttttcctcacctgtcctcctccaccccagagggttt
caggatggaactgctggcagatatcttcagctccttctctttcctactggccacagtggc
cggagcatgccagctgttctgcatcagcctctgcttccttccctgggtctcctttcttca
ggcttcgctcccagaagccgtttgcaagcctcccttcttcctgctgccagatggtctctg
ttgatcacagttcagcctcctggtgtgcctcccttctccctccagccagtgactcctgac
caccaagccacacacaccccctcgctgccaacacctcttcagtttttttatatttatttt
attattttatatgttatgtttccctga

DBGET integrated database retrieval system