KEGG   Mus musculus (house mouse): 104886
Entry
104886            CDS       T01002                                 
Symbol
Rab15, 2310012G06Rik, AI840042
Name
(RefSeq) RAB15, member RAS oncogene family
  KO
K07908  Ras-related protein Rab-15
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    104886 (Rab15)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    104886 (Rab15)
   04031 GTP-binding proteins [BR:mmu04031]
    104886 (Rab15)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    104886 (Rab15)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   104886 (Rab15)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab15
    104886 (Rab15)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA
Other DBs
NCBI-GeneID: 104886
NCBI-ProteinID: NP_001334334
MGI: 1916865
Ensembl: ENSMUSG00000021062
UniProt: Q3TYH2 D3YTZ8 Q3TYB1
Position
12:complement(76844734..76869532)
AA seq 166 aa
MKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDV
DEYAPEGVQKILIGNKADEEQKRQVGREQGQQLAKEYGMDFYETSACTNLNIKESFTRLT
ELVLQAHRKELDGLRTRASNELALAELEEDEGKPEGPANSSKTCWC
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaagactatcgaagtagacggcatcaaagtgagaatacagatttgggacacagcaggg
caggagaggtaccagactatcacaaagcagtactatcggcgagcccagggaatattttta
gtctacgacattagcagtgagcgctcctatcagcatatcatgaagtgggtcagtgacgtg
gatgagtacgctccagaaggagtccagaagatcctaattgggaataaggctgatgaagag
cagaaacggcaggtggggagagagcaggggcagcagctggctaaggagtacggcatggac
ttctacgaaacaagtgcctgcaccaaccttaatattaaagagtccttcactcgtctgacg
gagctggtgctgcaggcccacaggaaagagctggatggtctccgaacacgtgccagcaac
gagctcgcactggccgagctggaggaggacgaaggcaaacctgagggcccagcaaactct
tcaaagacctgctggtgctga

DBGET integrated database retrieval system