KEGG   Mus musculus (mouse): 104910Help
Entry
104910            CDS       T01002                                 

Gene name
Slc25a47, AI132487, AI876593, HDMCP
Definition
(RefSeq) solute carrier family 25, member 47
  KO
K15123  solute carrier family 25, member 45/47
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    104910 (Slc25a47)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   104910 (Slc25a47)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr DUF108
Motif
Other DBs
NCBI-GeneID: 104910
NCBI-ProteinID: NP_001012310
MGI: 2144766
Ensembl: ENSMUSG00000048856
UniProt: Q6IS41
Position
12; 12 F1
AA seq 310 aa AA seqDB search
MDFVAGAIGGVCGVAVGYPLDTVKVRIQTEAKYAGIWHCIRDTYRQERVWGFYRGLSLPV
CTVSLVSSVSFGTYHHCLAHICRFRYGSTDAKPTKADITLSGCASGLVRVFLTSPTEVAK
VRLQTQTQAQTQQRRSSASWTSGAPALCPTPTACLEPRPKYSGPLHCLVTVAREEGLRGL
YKGSSALLLREGHSFATYFLSYAMLCEWLTPAGHSQPDVLGVLVAGGCAGVLAWAVATPM
DVIKSRLQADGQGQHRYRGLLHCVVTSVREEGPRVLFKGLALNCCRAFPVNMVVFVAYEA
VLRLTQSLLT
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggattttgttgctggggccattggaggagtctgcggtgttgctgtgggctaccctctg
gatacagtgaaggtcagaatccagacggaggccaaatacgcaggcatctggcactgcatc
cgggacacgtatcgtcaagagcgggtgtggggcttctacaggggcctctcactgcccgtg
tgcacagtgtccctggtgtcgtctgtatcttttggtacctaccaccactgcctggctcac
atctgccgcttccggtacggcagcacggacgccaagcccaccaaggctgatatcacactc
tcaggatgtgcctctggtcttgtccgggtgttcctgacgtcacccactgaggtggccaaa
gtccgcctgcagacacagacccaagctcagacacagcagcggcggtcctcggcctcctgg
acatctggggctcccgctttgtgtcccacacccactgcttgcttggagcccaggcctaag
tacagtgggccactgcactgtttagtcacagtggctcgagaggaggggcttcggggactc
tacaagggcagctcggctctgctccttcgtgagggtcactcctttgccacctactttctc
tcctatgctatgctctgcgagtggctcacccctgctggccatagtcagccagatgtctta
ggtgtgttggtggctggaggctgcgctggggtcctggcctgggccgtggccacccccatg
gatgtgatcaagtcacgcctgcaggcggatgggcagggccagcatcgctaccggggcctc
ctgcactgtgtggtgaccagtgtacgggaggagggtcccagggtgctcttcaagggactg
gcactcaactgctgtcgtgcctttcctgttaacatggtggtctttgtggcgtatgaggct
gtgctgaggctcacgcagagcctgctcacatag

DBGET integrated database retrieval system