KEGG   Mus musculus (house mouse): 105193
Entry
105193            CDS       T01002                                 
Symbol
Nhlrc1, AI505271, B230309E09Rik, EPM2B
Name
(RefSeq) NHL repeat containing 1
  KO
K10602  E3 ubiquitin-protein ligase NHLRC1 [EC:2.3.2.27]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    105193 (Nhlrc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    105193 (Nhlrc1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     105193 (Nhlrc1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    105193 (Nhlrc1)
SSDB
Motif
Pfam: NHL zf-RING_5 zf-RING_2 zf-RING_UBOX Prok-RING_4 zf-C3HC4_3 zf-C3HC4_4 zf-C3HC4 Baculo_IE-1 FYVE zf-C3HC4_2 zf-RING_11
Other DBs
NCBI-GeneID: 105193
NCBI-ProteinID: NP_780549
MGI: 2145264
Ensembl: ENSMUSG00000044231
UniProt: Q8BR37 Q0VF71
Position
13:complement(47166033..47168326)
AA seq 401 aa
MGEEATAVAAAGVRPELVREAEVSLLECKVCFERFGHWQQRRPRNLPCGHVVCLACVAAL
AHPRTLGLECPFCRRACRACDTSDCLPVLHLLELLGSTLHASPAALSAAPFAPGTLTCYH
AFGGWGTLVNPTGLALCPKTGRVVVVHDGKRRVKIFDSGGGGAHQFGEKGDAAHDVKYPL
DVAVTNDCHVVVTDAGDCSLKVFDFFGQIKLVVGKQFSLPWGVEITPHNGVLVTDAEAGT
LHLLEADFPEGVLRRIERLQAHLCSPRGLAVSWLTGAIAVLEHPCAFGRTGCNNTRVKVF
NSTMQLIGQVDSFGLNLLFPSKVTASAVTFDHQGNVIVADTSGPAIVCLGKPEEFPALKP
IITHGLSRPVALAFTKENSLLVLDTASHSIKVFKVMEGNGG
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgggggaggaggcgacggcggtggcagcggctggggtgcggcccgagctggtgcgggag
gcggaggtcagcctgctggagtgcaaggtgtgcttcgagaggttcggccactggcagcag
cggcgcccgcgcaacctgccctgcggccacgtggtctgcttggcctgtgtcgccgctctc
gcgcacccgcggacgctgggcctcgagtgtcccttctgccggcgggcctgccgagcctgt
gacaccagcgattgcctgccggtgctgcacctcctggagctcctgggctccaccctccac
gcgtccccggctgccctcagcgccgcccccttcgcgccggggactctcacctgctaccac
gccttcggcgggtgggggaccctagtgaaccccacagggcttgcactgtgccccaagacc
ggacgggtagtggtcgtgcacgacgggaagagacgggtcaagatctttgactccggagga
ggaggtgcacaccagtttggagaaaagggggacgcagcgcacgacgtgaagtacccactg
gatgtcgccgtcaccaacgactgccatgtggttgtcaccgacgctggcgactgctccctc
aaagtgtttgatttctttggccagatcaagctggttgtgggaaagcagttttccctgcct
tggggtgtggagatcacccctcacaatggggtcctggtgactgatgcagaggcagggact
ttgcacctgctggaagcggatttccctgaaggggtccttcggaggattgagaggttgcaa
gctcacctatgcagtccccgtgggttggcagtgtcatggctcacgggggccatcgcggtc
ctagagcatccttgtgcctttgggaggactggctgtaacaacacaagggtgaaggtgttc
aactccactatgcagctgattggccaggtggatagcttcgggctgaacctcctcttcccc
tccaaagtaactgcctctgctgtgaccttcgatcaccaaggaaacgtgattgttgctgac
acctctggtccagccatcgtctgcttggggaaacccgaagaattcccagccctgaagcct
ataatcactcacggcctctcccgtcctgtggcactggccttcaccaaggagaattctctt
cttgtgctggatactgcatcccattctataaaagtctttaaagtgatggagggcaacgga
gggtga

DBGET integrated database retrieval system