KEGG   Mus musculus (mouse): 105242736
Entry
105242736         CDS       T01002                                 

Gene name
Gm6749, EG627371, Gm44122
Definition
(RefSeq) predicted pseudogene 6749
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    105242736 (Gm6749)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    105242736 (Gm6749)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    105242736 (Gm6749)
  09165 Substance dependence
   05034 Alcoholism
    105242736 (Gm6749)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    105242736 (Gm6749)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    105242736 (Gm6749)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    105242736 (Gm6749)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105242736 (Gm6749)
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 105242736
NCBI-ProteinID: XP_017177364
MGI: 3648518
Position
6; 6 E2
AA seq 142 aa
MGVAHTTARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPYRYRPGTVAHSEVRC
YPKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIH
AKRVTIMPKDIQLARHIHGELA
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggtgttgcccataccacggcgcgtacaaagcagactgctcgcaaatccaccggtggt
aaagcacccaggaaacaactggccacaaaagccgctcgcaagagtgcgccctctactgga
ggggtgaagaaaccttatcgttacaggcctggtactgtggcacacagtgaagtcagatgc
tatccaaagtccactgaacttctgatccgcaagctcccctttcagcgtctggtgcgagaa
attgctcaggacttcaaaacagatctgcgcttccagagtgcagctattggtgctttgcag
gaggcaagtgaggcctatctggttggcctttttgaagataccaacctgtgtgctatccat
gccaaacgtgtaacaattatgccaaaagatatccagctagcacgccacatacatggagaa
cttgcttaa

KEGG   Mus musculus (mouse): 115488119
Entry
115488119         CDS       T01002                                 

Gene name
Gm47655
Definition
(RefSeq) predicted gene, 47655
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    115488119 (Gm47655)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    115488119 (Gm47655)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    115488119 (Gm47655)
  09165 Substance dependence
   05034 Alcoholism
    115488119 (Gm47655)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    115488119 (Gm47655)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    115488119 (Gm47655)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    115488119 (Gm47655)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   115488119 (Gm47655)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S TMA7
Other DBs
NCBI-GeneID: 115488119
NCBI-ProteinID: XP_030103341
MGI: 6096739
Position
13 C1; 13
AA seq 136 aa
MARTKQTARKSTGDKAPRKQLATKAARKSAPSTGGVKKPHCYRPGTVALREIRSYQKSSE
LLIRKLPFQRLVLEIAQDFKTDLCFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDTQLAGYICRECA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtacgaagcagactgcccgcaaatccaccggtgataaagcacccaggaaacaa
ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat
tgttacaggcctggtactgtggcactccgtgaaatcagaagctatcagaagtcctccgaa
cttctgatccgcaagctcccctttcagcgtctggtgctagaaattgctcaggacttcaaa
acagatctgtgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat
ctggttggcctttttgaagataccaatctgtgtgctatccatgccaaacgtgtaacaatt
atgccaaaagatacccaactagcaggctacatatgcagagaatgtgcttaa

KEGG   Mus musculus (mouse): 115490335
Entry
115490335         CDS       T01002                                 

Gene name
Gm44180
Definition
(RefSeq) predicted gene, 44180
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    115490335 (Gm44180)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    115490335 (Gm44180)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    115490335 (Gm44180)
  09165 Substance dependence
   05034 Alcoholism
    115490335 (Gm44180)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    115490335 (Gm44180)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    115490335 (Gm44180)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    115490335 (Gm44180)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   115490335 (Gm44180)
SSDB
Motif
Pfam: Histone PAF CENP-S CENP-T_C
Other DBs
NCBI-GeneID: 115490335
NCBI-ProteinID: XP_030111550
MGI: 5690572
Position
6 E3; 6
AA seq 149 aa
MMSAVEFDGGVHTVARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTV
VLREIRCYQKSPELLIRKLPFQRLVREIAQDFKTDLCFQSAAIGALQEASQAYLVGLFED
TNLCAIHAKSVTIMPKDIQLALRILRERA
NT seq 450 nt   +upstreamnt  +downstreamnt
atgatgagtgctgtagaatttgatggaggtgtccataccgtggctcgcacaaagcagact
gctcgcaaatccaccggtggtaaagcacccaggaaacaactggctacaaaagccgctcgc
aagagtgcgccctctactggaggggtgaagaaacctcatcgttacaggcctggtactgtg
gtactccgtgaaatcagatgctatcagaagtcccctgaacttctgatccgcaagctcccc
tttcagcgtctggttcgagaaatcgctcaggacttcaaaacagatctgtgcttccagagt
gcagctattggtgctttgcaggaagcaagtcaggcttatctggttggcctttttgaagat
accaatctgtgtgctatccatgccaaaagtgtaacaattatgccaaaagatatccagcta
gcactccgcatactcagagaacgtgcataa

KEGG   Mus musculus (mouse): 15077
Entry
15077             CDS       T01002                                 

Gene name
H3c14, BE691662, H3-615, H3c13, H3c15, H3c2, H3c3, H3c4, H3c6, H3c7, H3f2, Hist2h3, Hist2h3c1, Hist2h3ca1
Definition
(RefSeq) H3 clustered histone 14
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    15077 (H3c14)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    15077 (H3c14)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    15077 (H3c14)
  09165 Substance dependence
   05034 Alcoholism
    15077 (H3c14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    15077 (H3c14)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15077 (H3c14)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    15077 (H3c14)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   15077 (H3c14)
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 15077
NCBI-ProteinID: NP_835734
MGI: 2448355
Ensembl: ENSMUSG00000093769
Vega: OTTMUSG00000021930
UniProt: P84228 B9EI85
Structure
PDB: 
5IX2

Position
3; 3 F2.1
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgtacgaagcagactgcccgcaagtccaccggcggcaaggccccgcgcaagcag
ctggccaccaaggccgcccgcaagagcgccccggccacgggcggcgtgaagaagccgcac
cgctaccggcccggcaccgtggcgctgcgggagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
acggacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgagcgaggcctac
ctggtggggctgttcgaggacaccaacctgtgcgccatccacgccaaacgcgtcaccatc
atgcccaaggacatccagttggcccgccgcatccgtggggagcgcgcttaa

KEGG   Mus musculus (mouse): 15078
Entry
15078             CDS       T01002                                 

Gene name
H3f3a, EyeLinc14, H3-3, H3-3a, H3-3b, H3.3, H3.3A
Definition
(RefSeq) H3.3 histone A
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    15078 (H3f3a)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    15078 (H3f3a)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    15078 (H3f3a)
  09165 Substance dependence
   05034 Alcoholism
    15078 (H3f3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    15078 (H3f3a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15078 (H3f3a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    15078 (H3f3a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   15078 (H3f3a)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 15078
NCBI-ProteinID: NP_032236
MGI: 1097686
Ensembl: ENSMUSG00000060743
Vega: OTTMUSG00000021525
UniProt: P84244
Structure
PDB: 
5XM0 5XM1

Position
1; 1 H4
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtacaaagcagactgcccgcaaatccaccggtggtaaagcacccaggaaacaa
ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat
cgttacaggcctggtactgtggccctccgtgaaatcagacgctatcagaagtccactgaa
cttctgatccgcaagctcccctttcagcgtctggtgcgagaaattgctcaggacttcaaa
acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat
ctggttggcctttttgaagataccaatctgtgtgctatccatgccaaacgtgtaacaatt
atgccaaaagatatccagctagcacgccgcatacgcggagaacgtgcttaa

KEGG   Mus musculus (mouse): 15081
Entry
15081             CDS       T01002                                 

Gene name
H3f3b, 9430068D06Rik, H3-3a, H3-3b, H3.3B
Definition
(RefSeq) H3.3 histone B
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    15081 (H3f3b)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    15081 (H3f3b)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    15081 (H3f3b)
  09165 Substance dependence
   05034 Alcoholism
    15081 (H3f3b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    15081 (H3f3b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15081 (H3f3b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    15081 (H3f3b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   15081 (H3f3b)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 15081
NCBI-ProteinID: NP_032237
MGI: 1101768
Ensembl: ENSMUSG00000016559
Vega: OTTMUSG00000003689
UniProt: P84244
Structure
PDB: 
5XM0 5XM1

Position
11; 11 E2
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgaaccaagcagaccgctaggaagtccaccggtgggaaagccccccgcaaacag
ctggccaccaaggcggctcggaaaagcgcgccctctaccggcggggtgaagaagcctcac
cgctacaggccagggaccgtggctctgagagagatccgtcgttaccagaaatcgactgag
ctgctcatccggaagctgccattccagagattggtgagggagatcgcccaggatttcaaa
accgacttgaggtttcaaagtgcagccatcggtgcccttcaggaggctagcgaagcatac
ctggtggggttgtttgaagataccaatctgtgtgccatccacgccaagagagtcaccatc
atgcccaaagacatccagttggctcgccggatacggggggagagagcttaa

KEGG   Mus musculus (mouse): 260423
Entry
260423            CDS       T01002                                 

Gene name
H3c7, H3.2-221, H3c13, H3c14, H3c15, H3c2, H3c3, H3c4, H3c6, Hist1, Hist1h, Hist1h3f
Definition
(RefSeq) H3 clustered histone 7
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    260423 (H3c7)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    260423 (H3c7)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    260423 (H3c7)
  09165 Substance dependence
   05034 Alcoholism
    260423 (H3c7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    260423 (H3c7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    260423 (H3c7)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    260423 (H3c7)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   260423 (H3c7)
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 260423
NCBI-ProteinID: NP_038576
MGI: 2448329
Ensembl: ENSMUSG00000100210
Vega: OTTMUSG00000000572
UniProt: P84228 B9EI85
Structure
PDB: 
5IX2

Position
13 A3.1; 13 9.78 cM
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtccactggcggcaaggccccgcgcaagcag
ctggccaccaaggccgcccgcaagagcgccccggccaccggcggcgtgaagaaacctcac
cgctaccgtcccggcaccgtggcgctgcgcgagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggctctgcaggaggcgagcgaggcctac
cttgtgggtctgtttgaggacaccaacctgtgcgccatccacgccaagcgtgtcaccatc
atgcccaaggacatccagctggcccgccgtatccgcggcgagcgggcttaa

KEGG   Mus musculus (mouse): 319148
Entry
319148            CDS       T01002                                 

Gene name
H3c3, H3-143, H3c13, H3c14, H3c15, H3c2, H3c4, H3c6, H3c7, Hist1h, Hist1h3c
Definition
(RefSeq) H3 clustered histone 3
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    319148 (H3c3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    319148 (H3c3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    319148 (H3c3)
  09165 Substance dependence
   05034 Alcoholism
    319148 (H3c3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    319148 (H3c3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    319148 (H3c3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    319148 (H3c3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319148 (H3c3)
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 319148
NCBI-ProteinID: NP_783584
MGI: 2448320
Ensembl: ENSMUSG00000069310
Vega: OTTMUSG00000000583
UniProt: P84228 B9EI85
Structure
PDB: 
5IX2

Position
13; 13 A3.1
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtccaccggcggcaaggccccgcgcaagcag
ctggccaccaaagccgcccgcaagagcgccccggccaccggcggcgtgaagaagcctcac
cgctaccgtcccggcaccgtggcgctgcgcgagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggctgtcatggctctgcaggaggcgagcgaggcctac
cttgtgggtctgtttgaggacaccaacctgtgcgccatccacgccaagcgtgtcaccatc
atgcccaaggacatccagctcgcccgccgcatccgcggagagagggcataa

KEGG   Mus musculus (mouse): 319149
Entry
319149            CDS       T01002                                 

Gene name
H3c4, H3-b, H3c13, H3c14, H3c15, H3c2, H3c3, H3c6, H3c7, Hist1h, Hist1h3d
Definition
(RefSeq) H3 clustered histone 4
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    319149 (H3c4)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    319149 (H3c4)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    319149 (H3c4)
  09165 Substance dependence
   05034 Alcoholism
    319149 (H3c4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    319149 (H3c4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    319149 (H3c4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    319149 (H3c4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319149 (H3c4)
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 319149
NCBI-ProteinID: NP_835511
MGI: 2448322
Ensembl: ENSMUSG00000099583
Vega: OTTMUSG00000000561
UniProt: P84228 B9EI85
Structure
PDB: 
5IX2

Position
13; 13 A3.1
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtccaccggcggcaaggccccgcgcaagcag
ctggccaccaaggccgcccgcaagagcgccccggccaccggcggcgtgaagaagcctcac
cgctaccgtcccggcaccgtggcgctgcgcgagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggctctgcaggaggcgagcgaggcctac
ctcgtgggtctgtttgaggacaccaacctgtgtgccatccacgccaagcgtgtcaccatc
atgcccaaggacatccagctggcccgtcgcattcgtggggagagggcgtaa

KEGG   Mus musculus (mouse): 319150
Entry
319150            CDS       T01002                                 

Gene name
H3c2, H3-53, H3c13, H3c14, H3c15, H3c3, H3c4, H3c6, H3c7, Hist1h, Hist1h3b
Definition
(RefSeq) H3 clustered histone 2
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    319150 (H3c2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    319150 (H3c2)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    319150 (H3c2)
  09165 Substance dependence
   05034 Alcoholism
    319150 (H3c2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    319150 (H3c2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    319150 (H3c2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    319150 (H3c2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319150 (H3c2)
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 319150
NCBI-ProteinID: NP_835510
MGI: 2448319
Ensembl: ENSMUSG00000069267
Vega: OTTMUSG00000000587
UniProt: P84228 B9EI85
Structure
PDB: 
5IX2

Position
13; 13 A3.1
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtccaccggcggcaaggccccgcgcaagcag
ctggccaccaaggccgcccgcaagagcgccccggccaccggcggcgtgaagaagcctcac
cgctaccgtcccggcaccgtggcgctgcgcgagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggctctgcaggaggcgagcgaggcctac
cttgtgggtctgtttgaggacaccaacctgtgcgccatccacgccaagcgtgtcaccatc
atgcccaaggacatccagctcgcccgccgcattcgtggggagagggcttaa

KEGG   Mus musculus (mouse): 319151
Entry
319151            CDS       T01002                                 

Gene name
H3c6, H3-f, H3.1, H3c13, H3c14, H3c15, H3c2, H3c3, H3c4, H3c7, Hist1h, Hist1h3e
Definition
(RefSeq) H3 clustered histone 6
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    319151 (H3c6)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    319151 (H3c6)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    319151 (H3c6)
  09165 Substance dependence
   05034 Alcoholism
    319151 (H3c6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    319151 (H3c6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    319151 (H3c6)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    319151 (H3c6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319151 (H3c6)
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 319151
NCBI-ProteinID: NP_835512
MGI: 2448326
Ensembl: ENSMUSG00000069273
Vega: OTTMUSG00000000554
UniProt: P84228 B9EI85
Structure
PDB: 
5IX2

Position
13; 13 A3.1
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtccaccggcggcaaggctccgcgcaagcag
ctggccaccaaggccgcccgcaagagcgccccggccaccggcggcgtgaagaagcctcac
cgctaccgtcccggcaccgtggcgctgcgcgaaatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggctctgcaggaggcgagcgaggcctac
ctcgtgggtctgtttgaggacaccaacctgtgcgccatccacgccaagcgtgtcaccatc
atgcccaaggacatccagctggcccgccgtatccgcggcgagcgggcttaa

KEGG   Mus musculus (mouse): 319152
Entry
319152            CDS       T01002                                 

Gene name
H3c10, H3-291, H3c1, H3c11, H3c8, Hist1h, Hist1h3h
Definition
(RefSeq) H3 clustered histone 10
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    319152 (H3c10)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    319152 (H3c10)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    319152 (H3c10)
  09165 Substance dependence
   05034 Alcoholism
    319152 (H3c10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    319152 (H3c10)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    319152 (H3c10)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    319152 (H3c10)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319152 (H3c10)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 319152
NCBI-ProteinID: NP_835513
MGI: 2448349
Ensembl: ENSMUSG00000101355
Vega: OTTMUSG00000000428
UniProt: P68433
Structure
PDB: 
5B1M 5IX2 1U35

Position
13; 13 A3.1
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtccaccggcggcaaggccccgcgcaagcag
ctggccaccaaggccgcccgcaagagcgccccggccaccggcggcgtgaagaagcctcac
cgctaccgtcccggcaccgtggcgctgcgcgagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggctctgcaggaggcctgtgaggcctac
ctcgtgggtctgtttgaggacaccaacctgtgcgccatccacgccaagcgtgtcaccatc
atgcccaaggacatccagctggcccgccgcatccgcggggagagggcttaa

KEGG   Mus musculus (mouse): 319153
Entry
319153            CDS       T01002                                 

Gene name
H3c11, H3-H, H3c1, H3c10, H3c8, Hist1, Hist1h3i
Definition
(RefSeq) H3 clustered histone 11
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    319153 (H3c11)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    319153 (H3c11)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    319153 (H3c11)
  09165 Substance dependence
   05034 Alcoholism
    319153 (H3c11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    319153 (H3c11)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    319153 (H3c11)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    319153 (H3c11)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319153 (H3c11)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 319153
NCBI-ProteinID: NP_835514
MGI: 2448350
Ensembl: ENSMUSG00000101972
Vega: OTTMUSG00000000433
UniProt: P68433
Structure
PDB: 
5B1M 5IX2 1U35

Position
13; 13 A3.1
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtccaccggcggcaaggccccgcgcaagcag
ctggccaccaaggccgcccgcaagagcgccccggccaccggcggcgtgaagaagcctcac
cgctaccgtcccggcaccgtggcgctgcgcgagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggctgtcatggctctgcaggaggcctgtgaggcctac
ctcgtgggtctgtttgaggacaccaacctgtgcgccatccacgccaagcgtgtcaccatc
atgcccaaggacatccagctggcccgtcgcattcgcggggagagggcgtaa

KEGG   Mus musculus (mouse): 319154
Entry
319154            CDS       T01002                                 

Gene name
H3c13, H3-615, H3-616, H3c14, H3c15, H3c2, H3c3, H3c4, H3c6, H3c7, Hist2h, Hist2h3b
Definition
(RefSeq) H3 clustered histone 13
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    319154 (H3c13)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    319154 (H3c13)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    319154 (H3c13)
  09165 Substance dependence
   05034 Alcoholism
    319154 (H3c13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    319154 (H3c13)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    319154 (H3c13)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    319154 (H3c13)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319154 (H3c13)
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 319154
NCBI-ProteinID: NP_835587
MGI: 2448351
Ensembl: ENSMUSG00000074403
Vega: OTTMUSG00000042083
UniProt: P84228 B9EI85
Structure
PDB: 
5IX2

Position
3; 3 F2.1
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgtacgaagcagaccgcccgcaagtccaccggcggcaaggccccgcgcaagcag
ctggccaccaaggccgcccgcaagagcgccccggccacgggcggcgtgaagaagccgcac
cgctaccggcccggcaccgtggcgctgcgggagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
acggacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgagcgaggcctac
ctggtggggctgttcgaggacaccaacctgtgcgccatccacgccaaacgcgtcaccatc
atgcccaaggacatccagttggcccgccgcatccgtggggagcgcgcttaa

KEGG   Mus musculus (mouse): 360198
Entry
360198            CDS       T01002                                 

Gene name
H3c1, H3c10, H3c11, H3c8, Hist1, Hist1h3a
Definition
(RefSeq) H3 clustered histone 1
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    360198 (H3c1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    360198 (H3c1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    360198 (H3c1)
  09165 Substance dependence
   05034 Alcoholism
    360198 (H3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    360198 (H3c1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    360198 (H3c1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    360198 (H3c1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   360198 (H3c1)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 360198
NCBI-ProteinID: NP_038578
MGI: 2668828
Ensembl: ENSMUSG00000069265
Vega: OTTMUSG00000000578
UniProt: P68433
Structure
PDB: 
5B1M 5IX2 1U35

Position
13; 13 A3.1
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtccaccggcggcaaggccccgcgcaagcag
ctagccaccaaagccgcccgcaagagcgccccggccaccggcggcgtgaagaagcctcac
cgctaccgtcccggcaccgtggcgctgcgcgagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggctctgcaggaggcctgtgaggcctac
cttgtgggtctgtttgaggacaccaacctgtgcgccatccacgccaagcgtgtcaccatc
atgcccaaggacatccaactggcccgccgcatccgcggggagagggcgtaa

KEGG   Mus musculus (mouse): 382523
Entry
382523            CDS       T01002                                 

Gene name
H3f4, Gm12260, H304, H3mmT, H3t
Definition
(RefSeq) H3.4 histone
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    382523 (H3f4)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    382523 (H3f4)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    382523 (H3f4)
  09165 Substance dependence
   05034 Alcoholism
    382523 (H3f4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    382523 (H3f4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    382523 (H3f4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    382523 (H3f4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   382523 (H3f4)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 382523
NCBI-ProteinID: NP_001304932
MGI: 3651326
Structure
PDB: 
5B1L

Position
11; 11 B1.3
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYHPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcacgcaccaagcagacggcacggaagtcgacgggaggcaaggctccgcgcaagcag
ctagccacgaaggtggcccgcaagagcgccccggccaccgggggcgtgaagaagccgcac
cgctaccaccctggcacggtggcgctgcgcgagatccggcgctaccagaagtccaccgag
ctgctgattcgcaagttgccattccagcgcttggtgcgtgagatcgcccaggacttcaag
accgacctgcgcttccagagctccgcggtgatggcgctgcaggaggcctgcgagtcgtac
ctcgtggggctgttcgaagacacgaacctgtgcgctatccacgccaagcgggtgaccatc
atgcccaaagacatccagttggctcggcgcatccgcggagaacgggcttag

KEGG   Mus musculus (mouse): 625328
Entry
625328            CDS       T01002                                 

Gene name
H3f3c, Gm14384, H3mm11
Definition
(RefSeq) H3 histone, family 3C
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    625328 (H3f3c)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    625328 (H3f3c)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    625328 (H3f3c)
  09165 Substance dependence
   05034 Alcoholism
    625328 (H3f3c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    625328 (H3f3c)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    625328 (H3f3c)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    625328 (H3f3c)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   625328 (H3f3c)
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 625328
NCBI-ProteinID: NP_001357860
MGI: 3650546
Position
2; 2 E5
AA seq 136 aa
MALTKQTARKSTGGKAPRKQLATKATRKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcttacaaagcagactgcccgcaaatccaccggtggtaaagcacccaggaaacaa
ctggctacaaaagccactcgcaagagtgcgccctctactggaggggtgaagaaacctcat
cgttacaggcctggcactgtggcactccgtgaaatcagacgctatcagaagtccactgaa
cttctgatccgcaagctcccctttcagcgtctggtgcgagaaattgctcaggacttcaaa
acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat
ctggttggcctttttgaagataccaatctgtgtgctatccatgccaaacgtgtaacaatt
atgccaaaagatatccagctagcacgccgcatacgcggagaacgtgcttaa

KEGG   Mus musculus (mouse): 667250
Entry
667250            CDS       T01002                                 

Gene name
Gm12657, H3mm12
Definition
(RefSeq) predicted gene 12657
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    667250 (Gm12657)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    667250 (Gm12657)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    667250 (Gm12657)
  09165 Substance dependence
   05034 Alcoholism
    667250 (Gm12657)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    667250 (Gm12657)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    667250 (Gm12657)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    667250 (Gm12657)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   667250 (Gm12657)
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 667250
NCBI-ProteinID: NP_001074488
MGI: 3651714
Position
4; 4 C5
AA seq 136 aa
MARTKQTARKSTGGNSPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASGAFLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtacaaagcagactgcccgcaaatccacgggtggtaactcacccaggaaacaa
ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat
cgttacaggcctggtactgtggcactccgtgaaatcagacgctatcagaagtccactgaa
cttctgatccgcaagctcccctttcagcgtctggtgcgagaaattgctcaggacttcaaa
acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtggggccttt
ctggttggcctttttgaagataccaatctgtgtgctatccatgccaaacgtgtaacaatt
atgccaaaagatatccagctagcacgccgcatacgcggagaacgtgcttaa

KEGG   Mus musculus (mouse): 97114
Entry
97114             CDS       T01002                                 

Gene name
H3c15, H3-614, H3.2-614, H3c13, H3c14, H3c2, H3c3, H3c4, H3c6, H3c7, Hist2h3, Hist2h3c2, Hist2h3c2-ps, Hist2h3ca1, M32461
Definition
(RefSeq) H3 clustered histone 15
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    97114 (H3c15)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    97114 (H3c15)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    97114 (H3c15)
  09165 Substance dependence
   05034 Alcoholism
    97114 (H3c15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    97114 (H3c15)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    97114 (H3c15)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    97114 (H3c15)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   97114 (H3c15)
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 97114
NCBI-ProteinID: NP_473386
MGI: 2448357
Ensembl: ENSMUSG00000081058
Vega: OTTMUSG00000021934
UniProt: P84228 B9EI85
Structure
PDB: 
5IX2

Position
3; 3 F2.1
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgtacgaagcagactgcccgcaagtccaccggcggcaaggccccgcgcaagcag
ctggccaccaaggccgcccgcaagagcgccccggccacgggcggcgtgaagaagccgcac
cgctaccggcccggcaccgtggcgctgcgggagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
acggacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgagcgaggcctac
ctggtggggctgttcgaggacaccaacctgtgcgccatccacgccaaacgcgtcaccatc
atgcccaaggacatccagttggcccgccgcatccgtggggagcgcgcttaa

KEGG   Mus musculus (mouse): 97908
Entry
97908             CDS       T01002                                 

Gene name
H3c8, H3.1-221, H3c1, H3c10, H3c11, Hist1h, Hist1h3g, M32460
Definition
(RefSeq) H3 clustered histone 8
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    97908 (H3c8)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    97908 (H3c8)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    97908 (H3c8)
  09165 Substance dependence
   05034 Alcoholism
    97908 (H3c8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    97908 (H3c8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    97908 (H3c8)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    97908 (H3c8)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   97908 (H3c8)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 97908
NCBI-ProteinID: NP_659539
MGI: 2145541
Ensembl: ENSMUSG00000099517
Vega: OTTMUSG00000000570
UniProt: P68433
Structure
PDB: 
5B1M 5IX2 1U35

Position
13; 13 A3.1
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtctaccggcggcaaggccccgcgcaagcag
ctggccaccaaggccgcccgcaagagcgccccggccaccggcggcgtgaagaagcctcac
cgctaccgtcccggcactgtggcgctgcgcgagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggctctgcaggaggcctgtgaggcctac
ctcgtgggtctgtttgaggacaccaacctgtgcgccatccacgccaagcgtgtcaccatc
atgcccaaggacatccagctggcccgtcgcatccgcggggagagggcttaa

DBGET integrated database retrieval system