KEGG   Mus musculus (mouse): 105245
Entry
105245            CDS       T01002                                 

Symbol
Txndc5, AL022641, ERp46, PC-TRP
Name
(RefSeq) thioredoxin domain containing 5
  KO
K13984  thioredoxin domain-containing protein 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105245 (Txndc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    105245 (Txndc5)
   04131 Membrane trafficking [BR:mmu04131]
    105245 (Txndc5)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   105245 (Txndc5)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    105245 (Txndc5)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_2 OST3_OST6 Thioredoxin_6 Thioredoxin_7 HyaE Thioredoxin_8
Other DBs
NCBI-GeneID: 105245
NCBI-ProteinID: NP_663342
MGI: 2145316
Ensembl: ENSMUSG00000038991
Vega: OTTMUSG00000035033
UniProt: Q91W90 Q3TEE8
Position
13:complement(38684242..38712800)
AA seq 417 aa
MPPRPGRLLQPLAGLPALATLLLLLGARKGARAQEVEADSGVEQDPHAKHLYTADMFTHG
IQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTADSDVCSAQGVR
GYPTLKFFKPGQEAVKYQGPRDFETLENWMLQTLNEEPATPEPEAEPPRAPELKQGLYEL
SANNFELHVSQGNHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVC
SEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVMAA
EPTGDKGTVLALTEKSFEDTIAQGITFVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVT
IAEVDCTAERNVCSKYSVRGYPTLLLFRGGEKVGEHNGGRDLDSLHSFVLRQAKDEL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgcccccgcgcccaggacgcctcctccagccgctggccgggctgccggccctggccacg
ctcctgctgctgctcggggcgcgcaaaggcgcccgggcccaggaggtggaagcggacagc
ggggtcgagcaggacccgcacgccaagcacctgtatacggccgacatgttcacgcacggg
atccagagcgccgcgcacttcgtcatgttcttcgcgccctggtgtggacactgccagcgg
ctgcagccaacttggaatgacctgggagacaagtacaacagcatggaggatgccaaggtc
tacgtggccaaagtggactgcacggctgattccgacgtgtgctctgcccagggagtgcga
ggataccccaccctgaagttttttaagcctggacaagaagcagtgaagtaccagggtcct
agagactttgaaacactggaaaactggatgctgcagacactgaacgaggagccagccaca
ccggagccggaagcggaaccacccagagcccctgagctcaaacaggggttgtatgagctc
tcggccaacaactttgagctgcatgtttctcaaggcaaccactttatcaagttcttcgct
ccgtggtgcggtcactgcaaagctctggctccaacctgggagcagctggctctgggcctt
gaacattctgaaaccgtcaagattggcaaggttgactgcacgcagcactacgctgtctgc
tcagagcatcaggtcagaggctatccaactctgctctggtttcgagatggcaagaaggtg
gatcagtacaagggaaagcgggacttggagtcactgagagactatgtgcagtcccagctg
cagggttcagaggcagctccggagactgttgagccgtcagaggccccagtgatggctgct
gagcccacgggtgacaagggcactgtgctggcactcaccgagaagagcttcgaggacact
attgcacaggggataaccttcgtcaagttctatgctccgtggtgtggccactgtaagaat
ctggctcctacctgggaggagctctctaaaaaggaattcccaggcttgtcagatgtcacc
atcgcagaagtggactgcaccgctgagcgcaatgtctgcagcaagtactcggtacgaggt
tatcccacgttgctgcttttccgaggaggtgaaaaagtgggagaacacaacggaggtaga
gacctcgactccttacacagctttgttctgcgccaggcaaaggatgaactatag

DBGET integrated database retrieval system