KEGG   Mus musculus (mouse): 105245
Entry
105245            CDS       T01002                                 

Gene name
Txndc5, AL022641, ERp, ERp46, PC-, PC-TRP
Definition
(RefSeq) thioredoxin domain containing 5
  KO
K13984  thioredoxin domain-containing protein 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105245 (Txndc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    105245 (Txndc5)
   04131 Membrane trafficking [BR:mmu04131]
    105245 (Txndc5)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   105245 (Txndc5)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    105245 (Txndc5)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_2 OST3_OST6 Thioredoxin_8 HyaE Thioredoxin_7
Other DBs
NCBI-GeneID: 105245
NCBI-ProteinID: NP_663342
MGI: 2145316
Ensembl: ENSMUSG00000038991
Vega: OTTMUSG00000035033
UniProt: Q91W90 Q3TEE8
Position
13; 13 A3.3
AA seq 417 aa
MPPRPGRLLQPLAGLPALATLLLLLGARKGARAQEVEADSGVEQDPHAKHLYTADMFTHG
IQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTADSDVCSAQGVR
GYPTLKFFKPGQEAVKYQGPRDFETLENWMLQTLNEEPATPEPEAEPPRAPELKQGLYEL
SANNFELHVSQGNHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVC
SEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVMAA
EPTGDKGTVLALTEKSFEDTIAQGITFVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVT
IAEVDCTAERNVCSKYSVRGYPTLLLFRGGEKVGEHNGGRDLDSLHSFVLRQAKDEL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgcccccgcgcccaggacgcctcctccagccgctggccgggctgccggccctggccacg
ctcctgctgctgctcggggcgcgcaaaggcgcccgggcccaggaggtggaagcggacagc
ggggtcgagcaggacccgcacgccaagcacctgtatacggccgacatgttcacgcacggg
atccagagcgccgcgcacttcgtcatgttcttcgcgccctggtgtggacactgccagcgg
ctgcagccaacttggaatgacctgggagacaagtacaacagcatggaggatgccaaggtc
tacgtggccaaagtggactgcacggctgattccgacgtgtgctctgcccagggagtgcga
ggataccccaccctgaagttttttaagcctggacaagaagcagtgaagtaccagggtcct
agagactttgaaacactggaaaactggatgctgcagacactgaacgaggagccagccaca
ccggagccggaagcggaaccacccagagcccctgagctcaaacaggggttgtatgagctc
tcggccaacaactttgagctgcatgtttctcaaggcaaccactttatcaagttcttcgct
ccgtggtgcggtcactgcaaagctctggctccaacctgggagcagctggctctgggcctt
gaacattctgaaaccgtcaagattggcaaggttgactgcacgcagcactacgctgtctgc
tcagagcatcaggtcagaggctatccaactctgctctggtttcgagatggcaagaaggtg
gatcagtacaagggaaagcgggacttggagtcactgagagactatgtgcagtcccagctg
cagggttcagaggcagctccggagactgttgagccgtcagaggccccagtgatggctgct
gagcccacgggtgacaagggcactgtgctggcactcaccgagaagagcttcgaggacact
attgcacaggggataaccttcgtcaagttctatgctccgtggtgtggccactgtaagaat
ctggctcctacctgggaggagctctctaaaaaggaattcccaggcttgtcagatgtcacc
atcgcagaagtggactgcaccgctgagcgcaatgtctgcagcaagtactcggtacgaggt
tatcccacgttgctgcttttccgaggaggtgaaaaagtgggagaacacaacggaggtaga
gacctcgactccttacacagctttgttctgcgccaggcaaaggatgaactatag

KEGG   Mus musculus (mouse): 12304
Entry
12304             CDS       T01002                                 

Gene name
Pdia4, AI987846, C, Cai, ERp, ERp-72, Erp72
Definition
(RefSeq) protein disulfide isomerase associated 4
  KO
K09582  protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12304 (Pdia4)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    12304 (Pdia4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    12304 (Pdia4)
   04131 Membrane trafficking [BR:mmu04131]
    12304 (Pdia4)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     12304 (Pdia4)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   12304 (Pdia4)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    12304 (Pdia4)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 Calsequestrin AhpC-TSA TraF Ribosomal_60s PMC2NT
Other DBs
NCBI-GeneID: 12304
NCBI-ProteinID: NP_033917
MGI: 104864
Ensembl: ENSMUSG00000025823
Vega: OTTMUSG00000057218
UniProt: P08003 A0A0R4J0Z1
Structure
PDB: 
2DJ1 2DJ2 2DJ3

Position
6 B2.3; 6 22.94 cM
AA seq 641 aa
MKLRKAWLLVLLLALTQLLAAASAGDAHEDTSDTENATEEEEEEEEEDDDDLEVKEENGV
WVLNDGNFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATS
ASMLASKFDVSGYPTIKILKKGQAVDYDGSRTQEEIVAKVREVSQPDWTPPPEVTLSLTK
DNFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLA
KRFDVSGYPTLKIFRKGRPFDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFLKDGD
DVVIIGLFQGDGDPAYLQYQDAANNLREDYKFHHTFSPEIAKFLKVSLGKLVLTHPEKFQ
SKYEPRFHVMDVQGSTEASAIKDYVVKHALPLVGHRKTSNDAKRYSKRPLVVVYYSVDFS
FDYRAATQFWRNKVLEVAKDFPEYTFAIADEEDYATEVKDLGLSESGEDVNAAILDESGK
KFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDAIVMDPKK
DVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKMDATANDITNDQYKVEGFPTIY
FAPSGDKKNPIKFEGGNRDLEHLSKFIDEHATKRSRTKEEL
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgaagctccggaaagcttggctgttggtcctgctcttggcgctgacacagctgctggct
gctgcgagcgccggagatgcacacgaagatacttcagatacagaaaatgccactgaggag
gaagaggaggaagaggaagaggatgacgatgacttggaagttaaggaagaaaatggtgtt
tgggtcttaaatgatgggaactttgataactttgtggctgacaaagatacagtgctactg
gagttctatgcaccatggtgtggacactgcaagcagtttgctccagaatatgagaaaatt
gccagtactttgaaggataatgatcctcccattgctgtagcgaagatcgatgcaacctca
gcatccatgctagccagcaaatttgatgtgagtggctaccccaccatcaagatcctgaag
aagggacaggccgttgactatgatggctccaggacccaggaagaaattgttgccaaagtc
agagaagtttcccagcctgattggacacctccacctgaagtcactctttcattgactaaa
gataactttgacgatgttgtaaataatgcagacattattttggtggagttctatgccccg
tggtgtggacactgcaagaaacttgcccctgagtatgagaaagctgccaaggagctcagc
aagcgctctcccccaattcccttagccaaagtggacgccaccgaacagacagacctggct
aagaggtttgatgtctctggctacccgactttgaaaattttccgcaaaggaaggcctttt
gactacaatggcccacgagagaaatatgggattgttgactacatgattgagcagtctggg
cctccctcaaaggagatcctgaccctgaagcaggtccaggagttcctgaaggatggagat
gatgtggtcatcattgggctctttcagggagatggtgacccggcctacttgcagtatcag
gatgctgctaacaacctgagagaagattacaagtttcaccacactttcagccctgaaata
gccaagttcctgaaagtctccctggggaagttggtgctgacacaccctgagaagttccag
tccaagtatgagcccaggttccacgtgatggatgttcagggctctacagaagcatcagcc
attaaggactatgtagtgaaacatgccttgcccctggtgggccatcgtaagacttctaat
gatgctaagcggtacagcaaacgccccctggtggttgtatactacagtgtggacttcagc
tttgattacagagctgctactcagttttggcgtaacaaagtcctagaggtggccaaggac
ttccctgagtataccttcgccattgctgacgaggaagactatgccacggaggtgaaggac
ctggggctcagtgagagtggagaggatgtcaatgcagccatcctagacgagagcgggaag
aagtttgccatggagccagaggagtttgattcagacactctccgggaatttgtcacagct
tttaaaaaaggaaaactaaagccagtcatcaaatcacagccagtacccaagaacaacaag
ggaccagtcaaggtggtggtgggaaagacctttgatgccattgtgatggaccccaaaaag
gacgtcctcattgaattctatgcaccctggtgtgggcactgcaagcagctagagcctatc
tataccagcctaggcaagaaatacaagggccagaaggacctggtcatcgccaagatggat
gctactgccaacgacatcaccaacgaccaatataaggtggagggcttccctaccatctat
tttgctcccagtggggacaaaaagaacccaattaaatttgagggtggcaacagagatctg
gagcatttgagcaagtttatagatgaacatgccacaaagaggagcaggaccaaggaagag
ctttaa

KEGG   Mus musculus (mouse): 18453
Entry
18453             CDS       T01002                                 

Gene name
P4hb, ERp, ERp59, P, PDI, Pd, Pdia1, Thb, Thbp
Definition
(RefSeq) prolyl 4-hydroxylase, beta polypeptide
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    18453 (P4hb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    18453 (P4hb)
   04131 Membrane trafficking [BR:mmu04131]
    18453 (P4hb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    18453 (P4hb)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     18453 (P4hb)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   18453 (P4hb)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    18453 (P4hb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   18453 (P4hb)
  Exosomal proteins of colorectal cancer cells
   18453 (P4hb)
  Exosomal proteins of bladder cancer cells
   18453 (P4hb)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 OST3_OST6 Thioredoxin_7 ERp29_N AhpC-TSA Thioredoxin_8 Redoxin Thioredoxin_3 HyaE
Other DBs
NCBI-GeneID: 18453
NCBI-ProteinID: NP_035162
MGI: 97464
Ensembl: ENSMUSG00000025130
Vega: OTTMUSG00000004095
UniProt: P09103
Position
11 E2; 11 84.27 cM
AA seq 509 aa
MLSRALLCLALAWAARVGADALEEEDNVLVLKKSNFEEALAAHKYLLVEFYAPWCGHCKA
LAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTA
GREADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVIGFFKDVESDSAKQFLLAAEA
IDDIPFGITSNSGVFSKYQLDKDGVVLFKKFDEGRNNFEGEITKEKLLDFIKHNQLPLVI
EFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSSFKRAAEGFKGKILFIFIDSDHTDN
QRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITEFCHRFLEGKIKPHLMSQ
EVPEDWDKQPVKVLVGANFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHE
NIIIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGA
GDDEDLDLEEALEPDMEEDDDQKAVKDEL
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgctgagccgtgctttgctgtgcctagccctggcctgggcggctagggtgggcgccgac
gccctggaggaggaggacaacgtcctggtgttgaagaagagcaacttcgaggaggcgctg
gcggcgcacaagtacctgctggtggagttctatgccccgtggtgtggccactgcaaagct
ctggctcccgagtatgccaaagctgccgcaaaactgaaggcagaaggctctgagattcga
ctagcaaaggtggatgccacagaagagtctgacctggctcagcagtatggtgtccgtggc
taccccacaatcaagttcttcaagaatggagacacagcctccccaaaggaatatacagct
ggcagggaagctgatgacattgtcaactggctgaagaaacgcacgggcccagcagctaca
accctgtctgacactgcagctgcagagtccttggtggactcaagcgaagtgacggtcatc
ggtttcttcaaggacgtagagtcagactctgccaagcagttcttgctggcagcagaggct
attgatgacataccttttggaatcacgtccaacagtggtgtgttctccaagtaccagctg
gacaaagatggggtggtcctctttaagaagtttgatgaaggccgcaacaactttgagggt
gagatcaccaaggagaagcttctagacttcatcaagcacaatcagctgcctttggtcatc
gagttcactgaacagacagctccgaagatttttggaggtgagatcaagacacacattctg
ctgttcctgcccaagagtgtatctgactatgacggcaagctgagcagcttcaagagagca
gccgagggcttcaagggcaagatcctatttatcttcatcgatagcgaccacactgataac
cagcgcatacttgagttctttggcctgaagaaggaggagtgtcccgctgtgcggcttatt
accctagaggaagagatgaccaagtacaaaccagagtcagatgagctgacggctgagaaa
atcacagagttttgccaccgcttcttagagggcaagatcaagccccacctgatgagccaa
gaagtgcctgaagactgggacaaacagccggtaaaagtactggttggggcgaactttgaa
gaggtcgcttttgatgagaaaaagaacgtgtttgttgaattctatgccccttggtgtggt
cactgcaagcagctagcccccatttgggataaactgggagagacatacaaggatcatgag
aatatcatcattgctaagatggactcaacagccaatgaggtggaagctgtcaaagtacat
agctttcccacactgaagttcttcccagcaagtgcagacagaacggtcattgattacaac
ggcgagcggacactggacggttttaagaaattcttggagagtggtggccaggatggagca
ggggacgatgaggacctcgacctagaagaagctttagagccagacatggaggaagacgac
gatcagaaagctgtgaaggatgaactgtag

KEGG   Mus musculus (mouse): 67397
Entry
67397             CDS       T01002                                 

Gene name
Erp29, 1200015M03Rik, 2810446M09Rik, AW209030, Erp, Erp28, Erp31, PDI-, PDI-Db
Definition
(RefSeq) endoplasmic reticulum protein 29
  KO
K09586  endoplasmic reticulum protein 29
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    67397 (Erp29)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67397 (Erp29)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    67397 (Erp29)
SSDB
Motif
Pfam: ERp29_N ERp29
Other DBs
NCBI-GeneID: 67397
NCBI-ProteinID: NP_080405
MGI: 1914647
Ensembl: ENSMUSG00000029616
Vega: OTTMUSG00000023477
UniProt: P57759
Position
5; 5 F
AA seq 262 aa
MAAAAGVSGAASLSPLLSVLLGLLLLFAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLV
KFDTQYPYGEKQDEFKRLAENSASSEELLVAEVGISDYGDKLNMELSEKYKLDKESYPVF
YLFRDGDLENPVLYNGAVKVGAIQRWLKGQGVYLGMPGCLPAYDALAGEFIKASSIEARQ
AILKQGQDGLLSVKETEKKWASQYLKIMGKILDQGEDFPASEMARIGKLIENKMSDSKKE
ELQKSLNILTAFRKKEAEKEEL
NT seq 789 nt   +upstreamnt  +downstreamnt
atggccgccgccgccggggtgtctggcgctgcttctctctccccactgctgtccgtgctc
ctgggcctgctgctcctctttgctccgcacggcggcagcggcctacacacgaagggtgcc
cttcccttggacacagtcactttctacaaggtcattcccaaaagcaagttcgtcttggtg
aagttcgacacccagtacccctatggagagaagcaagatgagttcaagcgtctggctgag
aactcagcctccagcgaggagctcttggtggcagaggtggggatctcagactatggcgac
aagctgaacatggagctgagtgagaagtacaagctggacaaggagagctacccagtcttc
tacctattccgggatggggacttggagaaccctgtgctgtacaatggggcagttaaggtt
ggagccatccagcgctggctaaaggggcagggggtctacctgggcatgcctgggtgcctg
cctgcatacgatgccctggcaggcgagttcatcaaggcctccagcatagaggcccgacag
gccatcttgaaacagggacaggatggcctcctaagtgtgaaggaaacagagaagaagtgg
gctagccaatacctgaagatcatggggaagatcctggaccaaggtgaggactttccagcc
tctgagatggcccggatcggtaagctgatagagaacaagatgagtgacagcaagaaagaa
gagctacagaagagcttaaacatcctgacggccttccggaagaaggaggctgagaaggag
gagctgtga

KEGG   Mus musculus (mouse): 71853
Entry
71853             CDS       T01002                                 

Gene name
Pdia6, 1700015E05Rik, AL023058, C77895, CaB, CaBP5, P, P5, Txndc, Txndc7
Definition
(RefSeq) protein disulfide isomerase associated 6
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    71853 (Pdia6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    71853 (Pdia6)
   04131 Membrane trafficking [BR:mmu04131]
    71853 (Pdia6)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     71853 (Pdia6)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   71853 (Pdia6)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    71853 (Pdia6)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_6 Thioredoxin_7 Thioredoxin_8 OST3_OST6 Thioredoxin_3 AhpC-TSA FAD_binding_7
Other DBs
NCBI-GeneID: 71853
NCBI-ProteinID: NP_082235
MGI: 1919103
Ensembl: ENSMUSG00000020571
Vega: OTTMUSG00000023877
UniProt: Q922R8 Q3TML0
Structure
PDB: 
2DML

Position
12; 12 A1.1
AA seq 440 aa
MARLVLGLVSCTFFLAVSGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQR
LTPEWKKAATALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTG
EAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDV
WMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATMNQVLASRYGIKGFPTI
KIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKKTCEEHQLCVVA
VLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMA
AINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGSFPTITPREPWDGKDGELP
VEDDIDLSDVELDDLEKDEL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggctcgcctggtgctcggtctggtgagctgcaccttctttctagcagtcagcggtctg
tattcttctagtgatgatgtcatcgagttgacgccatcaaatttcaacagagaagttatt
cagagtgacggcctgtggcttgtagaattttatgcaccatggtgtggtcactgccagagg
ttaacaccagaatggaagaaagcagcaacggctttgaaagatgttgttaaagtcggggcc
gtcaatgcagacaaacatcagtccctgggaggtcagtatggtgtccagggatttcctacc
atcaagatatttggagctaacaaaaacaagccagaagattatcagggtggcagaacggga
gaagccattgtagatgccgccctcagtgccttgcgccagctcgtcaaggatcgccttggt
gggcggagtggtgggtacagttctggaaagcagggcagaggtgatagttcaagtaagaaa
gacgtggtagagctgacggatgacacctttgataagaatgtccttgacagtgaagacgtt
tggatggttgagttttatgctccgtggtgtggacactgcaaaaacctggagccagaatgg
gctgctgcggctacagaagtaaaggagcaaacaaagggaaaagtgaaactggcagctgtg
gatgccaccatgaatcaggttctggccagccgatacgggattaaaggattccctacaatc
aagatatttcagaaaggcgagtctcctgtggactatgatggtggtcggacgagatctgac
atagtgtcaagggccctcgatttgttctctgataatgcccctcctccagagctgcttgag
ataatcaacgaagacatagccaagaagacatgcgaggagcaccagctctgtgtcgtggcc
gtactgcctcacatcctggacactggagctgcaggcagaaactcttacttggaagttctt
ctgaaactggctgacaagtacaagaagaagatgtgggggtggctgtggacagaagctgga
gcccagtatgaactggagaacgcactagggattggagggttcgggtaccctgccatggca
gccatcaatgcacgcaagatgaaatttgctcttctcaaggggtctttcagtgaacaaggc
atcaatgagtttctcagggaactgtctttcgggcgtggctccacagcacccgtagggggt
ggttcctttcctaccatcactcccagggagccctgggatggcaaggatggtgagctccct
gtggaggacgacattgacctcagtgacgtggagctggatgacctggagaaggatgagttg
tga

DBGET integrated database retrieval system