KEGG   Mus musculus (mouse): 105439
Entry
105439            CDS       T01002                                 

Gene name
Slain1, 9630044O09Rik, AA675320, AW742596
Definition
(RefSeq) SLAIN motif family, member 1
  KO
K16580  SLAIN motif-containing protein 1/2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    105439 (Slain1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    105439 (Slain1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Microtubule-associated proteins
     105439 (Slain1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Cytoplasmic linker proteins (CLIPs)
     CLIP-associating proteins
      105439 (Slain1)
SSDB
Motif
Pfam: SLAIN bZIP_1
Other DBs
NCBI-GeneID: 105439
NCBI-ProteinID: NP_932131
MGI: 2145578
Ensembl: ENSMUSG00000055717
Vega: OTTMUSG00000034692
UniProt: Q68FF7
Position
14; 14 E2.3
AA seq 579 aa
MMAEQVKCASPVAASGAGPGPVVNAELEVKKLQELVRKLEKQNEQLRSRAASAAAAPHLL
LLQPPPPSAPPPAGACSPLATHRAPASTTSPGPGALGPAFPGTYCLPSPAPSLLCSLQPA
DAPFVYSKPAAGFFGGGGSPEPGTAGTPPGEAATPPLPPPTLLDEVEPLDLESLAAWSEE
DDYTWLYVGSSKTFTSPEKSPSPLQWCRHVLDNPTPEMEAARRSLRFRLEQGYTSRGSPL
SPQSSIDSELSTSELEDDSISMGYKLQDLTDVQIMARLQEESLRQDYASTSASVSRNSSS
VSLSSGKKGTCSDQEYDRYSLEDEEEFDHLPPPQPRLPRCSPFQRGIPHSQTFSSIRDCR
RSPSTQYFPSNNFQQPQYYPPQAQTADQQPNRTNGDKLRRSMPNLARMPSTAAASSNLSS
PVTVRSSQSFDSSLHGAGSGVSRVPSCIPSPGQIQHRVHSVGHFPVPIRQPLKATAYVSP
TVQGSSSSGSSGSSGGSGSGMPLSNGTQLYSTTGIPTPNKAAASGILGRSALPRPSLAIN
GSNLPRSKIAQPVRSFLQPPKPLSSLSTLRDGNWRDGCY
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgatggcggagcaggtgaaatgcgcctcgccggtggcggcctccggcgccggcccgggg
ccggtggtgaacgccgagctggaggtgaagaagctgcaggagctggtgcgcaagctggag
aagcagaacgagcagctgcgcagccgggcggccagtgcggccgccgccccgcacctgctg
ctgctgcagccgccgccgccctccgccccgccgccagccggggcctgcagcccgctcgcc
acgcacagggccccggccagcacgacctccccgggcccgggggcgctgggccccgcgttc
ccgggcacctactgcttgcccagccccgcgccctccctgctctgcagcctgcagccggct
gacgcgcccttcgtctactccaagccggcggcgggcttcttcggcggaggtggcagcccg
gaaccggggaccgcagggaccccgccgggggaagccgccacgccgccgttgccgcctcca
acgctgctggacgaggtggagccgctggacctggagagcttggccgcctggagcgaggag
gacgactacacctggttatatgttggctcttcaaagacattcacctcaccagagaaatcc
ccgagtcctttgcagtggtgtagacatgtcctagataacccaactcctgagatggaagca
gccagacgctctctgcgcttcagactggagcaaggttatacctccaggggctctccactt
agtccgcagtcatccatcgacagtgagctgagtacctcggagttggaggatgactctata
tccatgggatataaattacaggaccttactgatgttcagatcatggctcgtctgcaagaa
gagagtctcaggcaagactacgcttccacgtcagcatcagtgtccagaaacagttccagt
gtatccctgagttcagggaaaaaggggacatgcagtgatcaagagtatgatcgctacagc
ctggaggacgaggaagagtttgaccatctgccgccaccccagccccgtcttccgaggtgt
tcacctttccaaagagggatcccccactcacagactttctccagcatccgggattgcagg
aggagccccagtacccagtatttcccctcaaataacttccagcagccacagtattaccca
cctcaagcccagactgcagaccagcaaccaaataggaccaatggagataagctacgaaga
agcatgcctaatctggcccggatgccgagcaccgctgcggccagcagcaacctcagctct
cctgtgacagtgaggagcagtcagagctttgactccagcttgcatggagctggaagtggg
gtttctcgggtaccgtcctgcatcccgtcaccaggacagattcagcacagagttcacagc
gtgggccacttcccagtgcccatccggcagcccctgaaggccacagcctatgtgagccca
actgttcaaggcagcagcagcagcggcagcagtggtagcagcggcggcagcggcagcggc
atgcctttatccaatggcacgcagttatattccaccacgggcatccctactccgaacaaa
gctgcggcttctgggatcctgggtcgcagcgcccttccgagaccttcactggcaataaat
gggagtaacctgcctcggagcaagattgcacagcctgtcagaagcttcctgcagcctccc
aagcctctgtcttcactcagcacactgagggatggaaattggagagacggttgctactga

DBGET integrated database retrieval system