KEGG   Mus musculus (mouse): 105522Help
Entry
105522            CDS       T01002                                 

Gene name
Ankrd28, AI465466, AI604979, E430019N21Rik, mKIAA0379
Definition
(RefSeq) ankyrin repeat domain 28
  KO
K15502  serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    105522 (Ankrd28)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    105522 (Ankrd28)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105522 (Ankrd28)
   Protein phosphatase-6
    Regulatory subunits
     105522 (Ankrd28)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Protein phosphatase 6
     105522 (Ankrd28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3
Motif
Other DBs
NCBI-GeneID: 105522
NCBI-ProteinID: NP_001019775
MGI: 2145661
Ensembl: ENSMUSG00000014496
UniProt: Q505D1
Position
14; 14 B
AA seq 1053 aa AA seqDB search
MAFLKLRDQPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELL
ILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAV
KCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWA
AYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGN
TPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVN
MKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLIT
SGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLEC
LNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAAT
SDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTD
MLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVD
VLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLS
VLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGR
TPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDV
FQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQ
LLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGK
GHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGY
TPALACAPNKDVADCLALILATMMPVSSSSPLTSLTFNAINRYTNTSKTVSFEALPIMRN
EASSYCSFNNIGGEQEYLYTDVDELNDSDSETY
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcctcaaactccgcgaccagccatcactggtgcaagctatatttaatggtgat
ccagatgaagtccgagcactaatatttaagaaagaagatgttaactttcaggacaatgag
aagagaacccctttgcatgctgctgcctatcttggtgacgcagaaatcattgagctgctt
attttatctggagctagagttaatgccaaagacagcaaatggttgacacctttacacaga
gcagttgcatcgtgtagtgaggaagcagttcagatacttttgaagcattctgcagatgtt
aatgctcgagataaaaattggcagacccctttacacatagctgctgctaataaagctgta
aagtgcgctgaatctttggtacctcttctgagcaatgtgaacgtgtccgaccgagcagga
agaactgcattacatcatgcagctttcagtgggcatggtgagatggtcaaactactcttg
tccagaggtgccaatataaatgcttttgacaagaaagataggcgtgcaatccattgggca
gcatatatgggtcacattgaagtagtaaaattacttgtatctcatggagctgaagtgaca
tgtaaggataagaagtcttacacacctcttcatgcagcagcctctagtggaatgatcagt
gtagtcaaatatcttctagatcttggagttgatatgaatgaaccaaatgcctatggaaac
acacctcttcatgtggcctgttacaatggacaagatgttgttgtgaatgagctcatagac
tgtggtgctaatgtcaatcagaagaatgagaaagggttcactcctttgcactttgctgct
gcatcaacacatggagcactgtgtttagaacttctggttggcaatggagctgatgtcaat
atgaagagtaaagatgggaaaaccccactacatatgactgccctccacggtagattctcc
agatcacaaacgattatccagagtggagctgtaatagactgtgaagataagaatgggaac
acccctttgcatatagcagcccggtatggccatgagcttctaatcaacactcttattaca
agtggtgctgacactgcaaagcgtggtatacatggaatgttcccactccatttggcagcc
ttaagtggtttttcagattgctgcaggaaactcctttcttcaggatttgacatagatacc
ccagatgattttggcagaacctgtctacacgcagctgcagctggaggaaatttggagtgc
ctaaaccttctgctgaatactggtgcagacttcaacaaaaaggataaatttggaagatct
ccactgcactatgctgctgccaactgcaattaccagtgcctgtttgctcttgtgggatca
ggagcaagtgtgaatgaccttgatgagagaggctgcacacccctgcactatgcagctaca
tctgacacagacggcaagtgcctggaatacttactaagaaatgatgccaacccagggatc
cgggacaaacaaggctataatgcagttcactactcagctgcgtatggtcaccgtctgtgt
cttcaactgattgcaagtgaaactcctttagatgttttaatggaaacctcgggaacagac
atgttgagtgattcagataatagagcaacaataagccctttacatttggctgcttatcat
ggtcaccatcaagccctggaagtgttggtacagtctttgttagatcttgatgtaagaaat
agtagtggtagaacacccttagatcttgcagcctttaagggccatgttgaatgtgtggat
gtactcattaatcagggagcttcaatcctcgtaaaagattacgttttgaagagaacacct
atccatgcagcagcaacaaatggtcattcagaatgcttacggttattaataggaaatgca
gagccacagaatgcagtagatattcaagatggaaatggacagacacctcttatgctgtcg
gttctcaatgggcacacggactgtgtatactcactactgaacaaaggagcaaatgtagat
gccaaagacaagtggggaaggacagcgttgcacagaggggcagtgacaggccatgaagag
tgtgtagacgcattacttcaacatggtgctaagtgcttactacgggacagccggggtcgg
acacccatacacttgtcagcagcctgtggacacattggagttcttggagcccttttgcag
tcagcaacatctgtggatgcaaatccagccgtagtagacaatcatgggtatacagcactt
cactgggcttgctacaatggtcatgagacatgtgtggagctacttttagaacaggatgtt
ttccagaaaatagatggaaatgctttcagccccctgcattgtgccgtgatcaacgacaat
gaaggtgcagctgagatgctgattgattccttaggagccagcattgtgaatgccacagac
tcaaagggaagaactcctctccatgccgctgccttcacagaccatgtggagtgtttacaa
ctgctgctcagccagaatgctcaggtcaattccgcagactctaccggaaaaacacctctc
atgatggctgcagaaaacggacaaaccaatacagttgagatgctggttagcagtgctagt
gcagatctgacattacaagataagagtaaaaacaccgcccttcatttggcttgtggcaag
ggtcatgaaactagtgccttgttaattctggaaaagataacagatagaaacctcatcaat
gcaaccaacgcagccttgcaaacacctctgcatgttgctgcccgaaatgggctcacgatg
gttgttcaagagctcctggggaaaggagccagtgtgcttgctgttgatgagaatggctac
accccagctttggcctgtgctcccaataaggatgtggctgactgcctggctctcattttg
gccaccatgatgcctgtctcgtcaagtagcccattgacatccctgacattcaatgccatt
aaccgttataccaacacctcaaaaacagttagctttgaagccttgcctatcatgaggaat
gaagccagctcctactgcagttttaacaacattggtggcgagcaggagtacttgtacacc
gacgtggatgagctcaacgactctgactccgagacctactga

DBGET integrated database retrieval system