KEGG   Mus musculus (mouse): 105638Help
Entry
105638            CDS       T01002                                 

Gene name
Dph3, DELGIP1, DelgipP1, Desr1, KTI11, Zcsl2
Definition
(RefSeq) diphthamine biosynthesis 3
  KO
K15455  diphthamide biosynthesis protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    105638 (Dph3)
   03012 Translation factors [BR:mmu03012]
    105638 (Dph3)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator related proteins
    105638 (Dph3)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Elongation factors
   Elongation associated factors
    105638 (Dph3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CSL zf-RING_7
Motif
Other DBs
NCBI-GeneID: 105638
NCBI-ProteinID: NP_001271275
MGI: 1922658
Ensembl: ENSMUSG00000021905
Vega: OTTMUSG00000019770
UniProt: Q8K0W9
Structure
PDB: 

Position
14; 14 B
AA seq 82 aa AA seqDB search
MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFAITKEDLENGEDVATCPSCSLIIKVIYD
KDQFMCGETVPAPSTNKELVKC
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtttcacgacgaggtggagatcgaggactttcaatatgacgaggactcggag
acatatttctacccttgcccctgtggggataactttgccatcaccaaggaagatttggaa
aatggagaagatgtggccacgtgtcctagctgctcactcattataaaagtgatttatgac
aaagatcagttcatgtgtggagaaacagtcccagcaccttcaaccaacaaggagttagtt
aaatgctga

DBGET integrated database retrieval system