KEGG   Mus musculus (mouse): 105675Help
Entry
105675            CDS       T01002                                 

Gene name
Ppif, AW457192, CyP-D, CyP-F, CypD, PPIase
Definition
(RefSeq) peptidylprolyl isomerase F (cyclophilin F)
  KO
K09565  peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu05012  Parkinson disease
mmu05016  Huntington disease
mmu05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    105675 (Ppif)
   04022 cGMP-PKG signaling pathway
    105675 (Ppif)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    105675 (Ppif)
   05016 Huntington disease
    105675 (Ppif)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105675 (Ppif)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    105675 (Ppif)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     105675 (Ppif)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    105675 (Ppif)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 105675
NCBI-ProteinID: NP_598845
MGI: 2145814
Ensembl: ENSMUSG00000021868
Vega: OTTMUSG00000023363
UniProt: Q99KR7
Position
14; 14 A3
AA seq 206 aa AA seqDB search
MLALRCGPRLLGLLSGPRSAPLLLSATRTCSDGGARGANSSSGNPLVYLDVGADGQPLGR
VVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGRSIY
GSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVV
KKIESFGSKSGKTSKKIVITDCGQLS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctagcgctgcgttgcggcccccgcctgctcggtctgctctccggcccgcgctccgcg
ccgctgctcctctccgcgacccgtacctgcagcgacggcggagcccgcggcgcgaactct
tcctccgggaacccgctcgtgtacttggacgtgggcgccgatggacagccgctcggccgc
gtggtgctggagttaaaggcagatgtcgtgccaaagactgcagagaacttcagagcccta
tgcactggtgagaagggctttggctacaaaggctccaccttccacagggtgatcccagcc
ttcatgtgccaggctggcgacttcaccaaccacaatggcacaggagggaggtccatctac
ggaagccgctttcccgacgagaacttcacactgaagcatgtggggccaggtgtcctgtcc
atggcgaacgcaggccccaacaccaatggctctcagttctttatctgcacgataaagaca
gactggctagatggcaagcatgtcgtgttcggccatgtcaaagagggcatggatgttgtg
aagaaaatagaatctttcggctcaaaaagtgggaagacgtctaagaagattgtcatcaca
gactgtggccagttgagctaa

KEGG   Mus musculus (mouse): 11739Help
Entry
11739             CDS       T01002                                 

Gene name
Slc25a4, AU019225, Ant1, mANC1
Definition
(RefSeq) solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator), member 4
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04217  Necroptosis
mmu04218  Cellular senescence
mmu05012  Parkinson disease
mmu05016  Huntington disease
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    11739 (Slc25a4)
   04022 cGMP-PKG signaling pathway
    11739 (Slc25a4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    11739 (Slc25a4)
   04218 Cellular senescence
    11739 (Slc25a4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    11739 (Slc25a4)
   05016 Huntington disease
    11739 (Slc25a4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    11739 (Slc25a4)
   05164 Influenza A
    11739 (Slc25a4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    11739 (Slc25a4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    11739 (Slc25a4)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    11739 (Slc25a4)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   11739 (Slc25a4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 11739
NCBI-ProteinID: NP_031476
MGI: 1353495
Ensembl: ENSMUSG00000031633
Vega: OTTMUSG00000016487
UniProt: P48962
Position
8 B1.1; 8 26.22 cM
AA seq 298 aa AA seqDB search
MGDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVR
IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggggatcaggctttgagctttcttaaggacttcctggcaggtggcatcgccgccgcc
gtctccaagacggcggtcgccccgatcgagagggtcaaactgctgctgcaggtccagcat
gccagcaaacagatcagtgcagagaagcagtacaaaggcatcattgattgtgtcgtgaga
atccccaaggagcagggctttctctctttctggaggggtaacctggccaacgtgatccgg
tacttccccactcaagccctgaacttcgccttcaaagacaagtacaagcagatcttcctg
ggaggcgtggatcgccataagcagttctggcgctactttgctggtaacctggcctctggt
ggggcagctggggccacctccctctgcttcgtctacccgctggactttgctaggaccagg
ctggctgccgacgtgggcaagggatcttcccagcgagaattcaatgggctgggcgactgt
ctcaccaagatcttcaagtcggacggcctgaagggtctctaccagggtttcagtgtctct
gtccagggcatcatcatctacagagctgcctacttcggagtctatgacactgccaagggg
atgctgccagaccccaagaatgtgcacattatcgtgagctggatgattgcccagagtgtg
acagcggtggcggggctggtgtcctatccgtttgacactgttcgtcgtaggatgatgatg
cagtctggccggaaaggggctgatattatgtacacggggacacttgactgctggaggaag
attgcaaaagatgaaggagccaacgctttcttcaaaggtgcttggtccaatgtactgaga
ggcatgggtggtgcttttgtattggtattgtatgatgagatcaaaaaatatgtgtaa

KEGG   Mus musculus (mouse): 11740Help
Entry
11740             CDS       T01002                                 

Gene name
Slc25a5, Ant2
Definition
(RefSeq) solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator), member 5
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04217  Necroptosis
mmu04218  Cellular senescence
mmu05012  Parkinson disease
mmu05016  Huntington disease
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    11740 (Slc25a5)
   04022 cGMP-PKG signaling pathway
    11740 (Slc25a5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    11740 (Slc25a5)
   04218 Cellular senescence
    11740 (Slc25a5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    11740 (Slc25a5)
   05016 Huntington disease
    11740 (Slc25a5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    11740 (Slc25a5)
   05164 Influenza A
    11740 (Slc25a5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    11740 (Slc25a5)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    11740 (Slc25a5)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    11740 (Slc25a5)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   11740 (Slc25a5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 11740
NCBI-ProteinID: NP_031477
MGI: 1353496
Ensembl: ENSMUSG00000016319
Vega: OTTMUSG00000016520
UniProt: P51881 Q545A2
Position
X A3.3; X 21.2 cM
AA seq 298 aa AA seqDB search
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgccgctgtgtccttcgccaaggacttcttggccggtggagtggccgcagcc
atctccaagacagcggtagcacccatcgagagggtcaagctgctgctgcaggtgcagcat
gccagcaagcaaatcacggcagataagcaatacaagggcatcatagactgcgtggttcgt
atccccaaggaacagggagtcctgtccttctggcgtgggaacctggccaatgtcatcaga
tacttccccacccaggctctcaactttgccttcaaagataaatacaagcagatctttctg
ggtggtgtggacaagaggacccagttctggcgctactttgcagggaacctggcatcaggt
ggtgccgctggggctacatccttgtgctttgtgtaccctcttgattttgcccgtacccgt
ctagcagctgatgtgggcaaagctggagctgaaagggaattcaaaggccttggtgactgc
ctggttaagatctacaaatctgatgggattaagggcctgtaccaaggctttaatgtgtca
gtacagggcattatcatctaccgagctgcctactttggtatctatgacactgcaaaggga
atgctcccagatcccaagaatactcacatcttcatcagctggatgattgcacagtctgtc
actgctgtcgctggcctgacttcctatccttttgacacggttcgccgtcgtatgatgatg
cagtctggacgcaaaggaactgatatcatgtacacaggcacgcttgactgctggcggaag
atcgcgcgcgatgaagggagcaaggcttttttcaagggcgcatggtccaacgttctcaga
ggcatgggtggcgcctttgtgcttgtcttgtatgatgagatcaagaaatacacataa

KEGG   Mus musculus (mouse): 22333Help
Entry
22333             CDS       T01002                                 

Gene name
Vdac1, AL033343, Vdac5, mVDAC1, mVDAC5
Definition
(RefSeq) voltage-dependent anion channel 1
  KO
K05862  voltage-dependent anion channel protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04217  Necroptosis
mmu04218  Cellular senescence
mmu04621  NOD-like receptor signaling pathway
mmu04979  Cholesterol metabolism
mmu05012  Parkinson disease
mmu05016  Huntington disease
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    22333 (Vdac1)
   04022 cGMP-PKG signaling pathway
    22333 (Vdac1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    22333 (Vdac1)
   04218 Cellular senescence
    22333 (Vdac1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    22333 (Vdac1)
  09154 Digestive system
   04979 Cholesterol metabolism
    22333 (Vdac1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    22333 (Vdac1)
   05016 Huntington disease
    22333 (Vdac1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    22333 (Vdac1)
   05164 Influenza A
    22333 (Vdac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    22333 (Vdac1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    22333 (Vdac1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    22333 (Vdac1)
Ion channels [BR:mmu04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   22333 (Vdac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Porin_3
Motif
Other DBs
NCBI-GeneID: 22333
NCBI-ProteinID: NP_035824
MGI: 106919
Ensembl: ENSMUSG00000020402
Vega: OTTMUSG00000005626
UniProt: Q60932
Structure
PDB: 

Position
11 B1.3; 11 31.86 cM
AA seq 283 aa AA seqDB search
MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVNGSLET
KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKR
EHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETSKSRVTQSNFAVGYKTDEFQL
HTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQVDPDACFSAKVNNS
SLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgcctcccacatacgccgatcttggcaagtccgccagggatgtcttcaccaag
ggctacggctttggcttaataaaacttgatttgaaaacgaagtcagagaatggattggaa
tttaccagctcaggctctgccaacacggaaaccaccaaagtgaacggcagcctggaaacc
aagtacagatggactgagtatgggctgacgtttacagagaagtggaacacagacaacacc
ctgggcactgagatcactgtggaagaccagcttgctcgtggactgaagctcacctttgat
tcgtcattctcgccgaacactgggaaaaaaaatgctaaaatcaagacagggtacaagagg
gagcacatcaacctcggctgtgacgtggactttgacatcgctgggccctcgatccggggc
gctctggtgcttggctatgagggttggctggctggctaccagatgaattttgagacctcg
aagtcccgagtgacccagagcaacttcgcagttggctataagacggatgaattccagctt
catactaatgtgaatgacgggacagagtttggtggctccatttaccagaaggtgaacaag
aagttggagactgctgtcaatctcgcctggactgcaggaaacagtaacactcgcttcgga
atagcagccaagtatcaggtcgaccctgatgcctgcttttcggccaaagtgaacaactct
agcctgattggcttagggtacactcagaccctaaaaccaggtatcaaactgacgttgtca
gccctgctcgatggcaagaacgtcaatgcgggtggccacaagcttggcctaggactggaa
tttcaagcataa

KEGG   Mus musculus (mouse): 22334Help
Entry
22334             CDS       T01002                                 

Gene name
Vdac2, Vdac6, mVDAC2, mVDAC6
Definition
(RefSeq) voltage-dependent anion channel 2
  KO
K15040  voltage-dependent anion channel protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04216  Ferroptosis
mmu04217  Necroptosis
mmu04218  Cellular senescence
mmu04621  NOD-like receptor signaling pathway
mmu04979  Cholesterol metabolism
mmu05012  Parkinson disease
mmu05016  Huntington disease
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    22334 (Vdac2)
   04022 cGMP-PKG signaling pathway
    22334 (Vdac2)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    22334 (Vdac2)
   04217 Necroptosis
    22334 (Vdac2)
   04218 Cellular senescence
    22334 (Vdac2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    22334 (Vdac2)
  09154 Digestive system
   04979 Cholesterol metabolism
    22334 (Vdac2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    22334 (Vdac2)
   05016 Huntington disease
    22334 (Vdac2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    22334 (Vdac2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    22334 (Vdac2)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    22334 (Vdac2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    22334 (Vdac2)
Ion channels [BR:mmu04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   22334 (Vdac2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Porin_3
Motif
Other DBs
NCBI-GeneID: 22334
NCBI-ProteinID: NP_035825
MGI: 106915
Ensembl: ENSMUSG00000021771
Vega: OTTMUSG00000016381
UniProt: Q60930
Position
14 A3; 14 11.91 cM
AA seq 295 aa AA seqDB search
MAECCVPVCPRPMCIPPPYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSN
TDTGKVSGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTG
KKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRSN
FAVGYRTGDFQLHTNVNNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLD
PTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSFNAGGHKLGLALELEA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtgctgtgtaccggtatgcccacggccgatgtgtatccctccaccctatgct
gacctcggcaaagctgccagagacattttcaacaaaggatttggctttgggctggtgaag
ctggatgtgaagacgaagtcatgcagcggtgtggaattttcaacatctggctcatctaat
acagacactggtaaagttagcgggaccttggagaccaagtacaaatggtgtgagtatggt
ctgactttcacagagaagtggaacaccgataacactctggggacagagattgcaattgaa
gaccagatttgtcaaggtttgaaactgacttttgacaccaccttttcaccgaacacagga
aagaaaagtggtaaaatcaagtctgcttacaagagggagtgtataaacctcggctgtgat
gttgactttgattttgctggacctgccatccatgggtcagctgtctttggttacgagggc
tggcttgctgggtaccaaatgacctttgacagtgccaagtcaaagctgacaaggagtaac
tttgcagtcggctacaggactggggacttccagctacacacaaatgtaaataatgggaca
gaatttggaggatcaatttatcagaaagtatgtgaagattttgacacttcagtaaacctc
gcttggacatcaggtaccaactgcactcgttttggcattgcagctaaataccagttggat
cctactgcttctatctctgcaaaggtcaacaactctagtttaattggagtgggctatact
cagactctgaggcctggtgtgaagcttacactgtctgctctggtagacgggaagagcttt
aatgctggaggccacaaacttgggcttgccttggaattggaggcttaa

KEGG   Mus musculus (mouse): 22335Help
Entry
22335             CDS       T01002                                 

Gene name
Vdac3
Definition
(RefSeq) voltage-dependent anion channel 3
  KO
K15041  voltage-dependent anion channel protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04216  Ferroptosis
mmu04217  Necroptosis
mmu04218  Cellular senescence
mmu04621  NOD-like receptor signaling pathway
mmu04979  Cholesterol metabolism
mmu05012  Parkinson disease
mmu05016  Huntington disease
mmu05161  Hepatitis B
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    22335 (Vdac3)
   04022 cGMP-PKG signaling pathway
    22335 (Vdac3)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    22335 (Vdac3)
   04217 Necroptosis
    22335 (Vdac3)
   04218 Cellular senescence
    22335 (Vdac3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    22335 (Vdac3)
  09154 Digestive system
   04979 Cholesterol metabolism
    22335 (Vdac3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    22335 (Vdac3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    22335 (Vdac3)
   05016 Huntington disease
    22335 (Vdac3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    22335 (Vdac3)
   05161 Hepatitis B
    22335 (Vdac3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    22335 (Vdac3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    22335 (Vdac3)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    22335 (Vdac3)
Ion channels [BR:mmu04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   22335 (Vdac3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Porin_3
Motif
Other DBs
NCBI-GeneID: 22335
NCBI-ProteinID: NP_035826
MGI: 106922
Ensembl: ENSMUSG00000008892
Vega: OTTMUSG00000060891
UniProt: Q60931 Q3TX38
Position
8 A2; 8 11.42 cM
AA seq 283 aa AA seqDB search
MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLET
KYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYRR
DCFSLGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQL
HTHVNDGTEFGGSIYQKVNERIETSINLAWTAGSNNTRFGIAAKYKLDCRTSLSAKVNNA
SLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaacacaccaacttattgcgacctaggaaaggctgccaaggatgtctttaacaaa
gggtatgggtttggcatggtcaagatagatctgaaaaccaagtcttgtagtggagtggaa
ttttctacttcaggtcatgcttatactgatacagggaaagcatcaggcaacctagagacc
aaatataaggtctgcaactatgggctcaccttcacccaaaagtggaatacagacaatact
cttgggacagaaatctcttgggagaataagttggctgaagggttgaaactgactcttgat
accatatttgtaccaaacacaggaaagaagagtgggaaattaaaggcctcctatagacgg
gattgttttagtctcggcagtaatgttgatatagatttttctggaccgaccatctatggc
tgggctgtgttggcctttgaaggttggcttgctggctatcagatgagttttgacacagcc
aaatccaaactgtctcagaataatttcgctcttggttacaaggctgcagacttccagctg
catactcacgtgaatgatggcactgagtttggaggctcaatctaccagaaagttaacgag
aggattgaaacgtcaataaacctggcatggacagctggcagcaacaacactcgttttggc
atcgctgctaaatataagctggattgtagaacttctctatctgccaaagtaaacaatgcc
agtttaattggactgggttatacgcagaccctccgaccaggagtcaaactgaccctgtca
gctttaatagatggaaagaacttcaatgcaggaggccacaaggttggattgggatttgaa
ctggaggcttag

KEGG   Mus musculus (mouse): 73333Help
Entry
73333             CDS       T01002                                 

Gene name
Slc25a31, 1700034J06Rik, Ant4, Sfec
Definition
(RefSeq) solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04217  Necroptosis
mmu04218  Cellular senescence
mmu05012  Parkinson disease
mmu05016  Huntington disease
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    73333 (Slc25a31)
   04022 cGMP-PKG signaling pathway
    73333 (Slc25a31)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    73333 (Slc25a31)
   04218 Cellular senescence
    73333 (Slc25a31)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    73333 (Slc25a31)
   05016 Huntington disease
    73333 (Slc25a31)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    73333 (Slc25a31)
   05164 Influenza A
    73333 (Slc25a31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    73333 (Slc25a31)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    73333 (Slc25a31)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    73333 (Slc25a31)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   73333 (Slc25a31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 73333
NCBI-ProteinID: NP_848473
MGI: 1920583
Ensembl: ENSMUSG00000069041
Vega: OTTMUSG00000022633
UniProt: Q3V132 B2RTC8
Position
3; 3 B
AA seq 320 aa AA seqDB search
MSNESSKKQSSKKALFDPVSFSKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISP
EARYKGMLDCLVRIPREQGFLSYWRGNLANVIRYFPTQALNFAFKDKYKELFMSGVNKEK
QFWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDIGKGPEQRQFTGLGDCIMKIAKS
DGLIGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKETPFLVSFIIAQIVTTCSGIL
SYPFDTVRRRMMMQSGESDRQYKGTIDCFLKIYRHEGVPAFFRGAFSNILRGTGGALVLV
LYDKIKEFLNIDVGGSSSGD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgaatcctccaagaagcagtcttcaaagaaggcgctgttcgatccggtgtct
ttctcgaaggacctgctggccggcggggtcgcggccgcggtgtcgaagacagctgtggcg
cccatcgagcgtgtgaagctgctgctgcaggtgcaggcgtcctccaagcagataagccct
gaggcgcgctacaagggcatgctggactgcctggtgcgcattcctcgtgagcaaggattt
ttaagttattggcgtggcaatttggcaaatgttattcgatactttccaacacaagcctta
aacttcgcttttaaggacaaatacaaagaacttttcatgtctggtgttaataaagaaaaa
cagttctggagatggtttctagcaaacctggcttctggaggggctgctggagcaacatcc
ttgtgtgtagtatacccactagattttgccagaacccgattaggtgttgatattggaaaa
ggtcctgagcagcggcagttcacgggtttgggtgactgcattatgaaaatagccaagtca
gatggactgattggtctataccaagggtttggtgtctctgttcagggtatcattgtttac
cgagcctcttactttggagcttatgacaccgttaagggcttattgccaaagccaaaggaa
accccatttcttgtctcttttatcattgctcaaatcgtgactacctgttctggaatactc
tcctatccctttgacacagttagaagacgtatgatgatgcagagtggggaatctgatcgg
caatataaaggaaccatagactgctttctgaaaatctaccgtcatgaaggagttcctgcc
ttcttccgtggtgccttctccaacatccttcgtggcacagggggtgctttggtcttggtg
ttatatgataaaatcaaagagttcctcaacattgatgttggaggtagttcatcaggagat
taa

DBGET integrated database retrieval system