KEGG   Mus musculus (mouse): 105727
Entry
105727            CDS       T01002                                 

Gene name
Slc38a1, AA408026, AA409865, AL022800, AU015942, NA, NAT2, SN, SNAT1
Definition
(RefSeq) solute carrier family 38, member 1
  KO
K14990  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04724  Glutamatergic synapse
mmu04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    105727 (Slc38a1)
   04727 GABAergic synapse
    105727 (Slc38a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    105727 (Slc38a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   105727 (Slc38a1)
SSDB
Motif
Pfam: Aa_trans Cation_ATPase_C
Other DBs
NCBI-GeneID: 105727
NCBI-ProteinID: NP_001159928
MGI: 2145895
Ensembl: ENSMUSG00000023169
UniProt: Q8K2P7
Position
15; 15 F1
AA seq 485 aa
MMHFKSGLELTELQNMTVPEDDNVSNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEK
RKCDEYIPGTTSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLILLTSVTLLSIYSIN
LLLICSKETGCMVYEKLGEQVFGTTGKLVIFGATSLQNTGAMLSYLFIVKNELPSAIKSL
MGEEDAFSAWYVDGRVLVVMVTFGIILPLCLLKNLGYLGYTSGFSLSCMMFFLIVVIYKK
FQTPCMSVEQNSTVSANVTDACTPKYVTFNSKTVYALPTIAFAFVCHPSVLPIYSELKDR
SQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYEKVQSDLLHKYQSTGDILILTVRLAVIV
AVILTVPVLFFTVRSSLFELAKKTKFHLCRHVLVTIILLIIINLLVIFIPSMKDIFGVVG
VTSANMLIFILPSSLYLKITNQDGDKGTQRIWAALFLGLGVLFSLISIPLVIYDWACSSG
TDEGH
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgatgcatttcaaaagtggcctcgagctaacggagctgcagaacatgacggtgcccgaa
gatgacaacgtcagcaacgactctaatgacttcacagaagtagaaaacggccagataaat
agcaagttcatctcagatcgggagagtaggaggagtctcacaaacagccatctggagaaa
aggaaatgcgacgagtatattccaggaacaacctccctgggaatgtctgtctttaacctg
agcaacgccatcatgggcagtggaatcttgggccttgccttcgccttggccaacaccggg
atcctcctctttctgatacttctgacttcggtgacactgctgtctatatattcaataaac
ctactgctgatctgttccaaggaaaccggctgcatggtgtatgagaagctgggagagcaa
gtcttcggcaccacggggaagctggtgatcttcggagccacctctctgcagaacactggg
gcgatgctgagctacctcttcatagtaaaaaacgaacttccttcagccataaaatccctc
atgggagaggaggatgcattttcagcctggtacgtcgatggccgagtgttggtggtgatg
gtgacctttggcataatccttccgctgtgtctcttgaagaacctggggtatcttggctac
acgagtgggttttccctaagctgcatgatgtttttcctaatagtggtcatctacaagaaa
tttcagactccctgcatgagtgtggagcagaactcgacagtcagtgctaatgtgaccgac
gcgtgcacaccaaagtatgtcaccttcaactcaaagacggtgtatgctttaccaaccatc
gccttcgcgtttgtctgccacccgtccgtcctgccaatctacagcgagctcaaagaccgg
tcacagaagaaaatgcagatggtttccaacatctccttctttgctatgtttgtcatgtac
ttcctgacggccatctttgggtacttgacgttttatgaaaaggtgcagtcagatctcctt
cacaagtaccagagcacaggcgacattctcatcctaaccgtgcggctggccgtcatcgtg
gccgtcatcctcaccgtgcctgtgctgtttttcacagttcgatcatcgttatttgagctg
gccaagaagacaaagttccacctgtgccgccatgtcttggtgaccatcatactcttgatc
attatcaacctgttggtgatcttcatcccctccatgaaggatatctttggagtcgtagga
gtcacgtctgctaatatgctcattttcattcttccttcgtctctttatttaaaaatcacg
aaccaggacggagataaaggcactcaaagaatttgggcggcccttttcttgggcttgggg
gtgttgttctccttgatcagcatccctctggtcatctacgactgggcttgctcctctggc
accgacgaaggccactga

DBGET integrated database retrieval system