KEGG   Mus musculus (house mouse): 105782
Entry
105782            CDS       T01002                                 
Symbol
Scrib, AI118201, CRIB, Crc, SCRIB1, Scrb1, mKIAA0147, vartul
Name
(RefSeq) scribbled planar cell polarity
  KO
K16175  protein scribble
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu05165  Human papillomavirus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    105782 (Scrib)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    105782 (Scrib)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    105782 (Scrib)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105782 (Scrib)
SSDB
Motif
Pfam: PDZ PDZ_6 LRR_8 LRR_4 PDZ_2 Peptidase_M50 LRR_9 MscS_porin
Other DBs
NCBI-GeneID: 105782
NCBI-ProteinID: NP_001297472
MGI: 2145950
Ensembl: ENSMUSG00000022568
UniProt: Q80U72
Position
15:complement(75919011..75941633)
AA seq 1612 aa
MLKCIPLWRCNRHVESVDKRHCSLQVVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLN
LRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRL
PDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLD
LGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPVELG
GLALLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENL
LTALPHSLGKLTKLTNLNVDRNHLEVLPPEIGGCVALSVLSLRDNRLAVLPPELAHTAEL
HVLDVAGNRLRSLPFALTHLNLKALWLAENQAQPMLRFQTEDDAQTGEKVLTCYLLPQQP
LPSLEDAGQQSSPSESCSDAPLSRVSVIQFEDTLEGEEDAEEAAAEKRGLQRRATPHPSE
LKVMKRGIEERRNEAFVCKPDPSPPSPSEEEKRLSAESALSGGSVPSASTASEGEPEILP
AEVQGLGQHEAMPAQEEYTEDDYNEPTVHFAEDTLIPREDGESEEGQPEAAWPLPSGRQR
LIRKDTPHYKKHFKISKLPQPEAVVALLQGVQTDREGPTAGWHNGPHTPWAPRAHEEEEE
EEEENRDEEEGEATTEEDDKEEAVASAPSVKGVSFDQANNLLIEPARIEEEELTLTIVRQ
TGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQDAEHH
EAVEALRGAGAAVQMRVWRERMVEPENAVTITPLRPEDDYSPREWRGGGLRLPLLQPETP
VSLRQRHAACLVRSEKGLGFSIAGGKGSTPYRAGDGGIFISRIAEGGAAHRAGTLQVGDR
VLSINGVDMTEARHDHAVSLLTAASPTISLLLERETGGTYPPSPPPHSSPTPAATVAATV
STAVPGEPLLPRLSPSLLATALEGPYPVEEICLPRAGGPLGLSIVGGSDHSSHPFGVQDP
GVFISKVLPRGLAARCGLRVGDRILAVNGQDVREATHQEAVSALLRPCLELCLLVRRDPP
PPGMRELCIQKAPGEKLGISIRGGAKGHAGNPCDPTDEGIFISKVSPTGAAGRDGRLRVG
LRLLEVNQQSLLGLTHAEAVQLLRSVGDTLTVLVCDGFDTSTTTALEVSPGVIANPFAAG
LGHRNSLESISSIDRELSPEGPGKEKELASQALPWESESAETTGRNLEPLKLDYRALAAL
PSAGSLQRGPSATTGGKTTEAPCSPGSQQPPSPDELPANVKQAYRAFAAVPTVHPPENSA
TQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLVGADDLRKMQEEEARKLQ
QKRAQMLREEAVTSGPDMGLASDRESPDDQQEAEQPWAVPSHAGGSSPSSPPPLGGNAPV
RTAKAERRHQERLRMQSPELPAPERALSPAERRALEAEKRALWRAARMKSLEQDALRAQM
VLSKSQEGRGKRGPLERLAEAPSPAPTPSPTPLEDFGLQTSASPGRLSPDFVEELRTLEA
SPSPGSQEEDGEVALVLLGRPSPGAVGPEDMTLCSSRRSVRPGRRGLGPVPS
NT seq 4839 nt   +upstreamnt  +downstreamnt
atgctgaagtgcatcccgctctggcgttgtaaccggcacgtggagtcggtggataagcgg
cactgctcgctgcaggttgtgccagaggagatttaccgctacagtcgtagcctcgaggag
ctgctcctcgacgccaaccagctgcgcgagctacctaagcccttcttccgactgttgaac
ttgagaaagttgggcctcagtgacaacgagatccagcggctgcctcctgaagtggccaac
ttcatgcagctggtggagctagatgtgtcccggaacgatattcctgagatacctgagagc
ataaagttctgtaaggctctggagattgcagacttcagtgggaaccccctgtctagactt
ccggatggcttcacacagctacgcagcctggctcacctggccctgaatgacgtgtccctg
caggcactgcctggagatgtgggcaacctggccaatctggtgaccctggaactccgggag
aacctgcttaaatctctccctgcgtccctgtctttcctggtgaagctggaacagctggat
ctgggaggcaacgacctggaagtgctgcctgacaccctgggggctctgcctaaccttcgg
gagctatggttagaccgaaaccaactgtcagcgctgcccccggagctaggcaatctgcgg
cggctggtgtgcctggatgtgtcagagaacaggctggaggagctgcctgtggagttgggt
gggctggcactgctcacggatctgctgctttcccagaacttgcttcagcggctgccagag
ggcatcggtcagctgaagcagctgtctatcctgaaggtggaccagaaccggctgtgtgag
gtcactgaggccataggggactgtgagaacctctcggagctgatcctcacggagaacctg
ttaacggccttaccccactcgctgggcaagctgaccaagctgactaacctcaatgtggac
cggaaccatcttgaggtgctgcctcctgaaatcggaggctgtgtggcccttagtgtcctc
tctttgagagacaatcgcctggctgtcctccctcctgagcttgcccataccgctgagctg
cacgtgcttgatgtggctgggaaccggctgcggagtctgccgtttgcgctcacccacctc
aacctcaaggcactgtggctggccgagaaccaggcacagcccatgctccgcttccagact
gaggatgatgcccagacgggtgaaaaggtgctcacctgctacctgctgccccagcagccc
ctgccaagtctcgaagacgctggacagcagagcagtccctcagagagctgtagtgatgcc
cctctgagccgtgtcagtgtcatccagttcgaggacaccctggaaggtgaagaggatgct
gaggaagctgcggccgagaagcggggcctacagcgtagggccacacctcatcccagtgag
ctcaaggtgatgaagaggggcattgaagagcgccggaatgaggccttcgtctgcaagcct
gaccccagcccaccctcgccttcagaggaggagaagaggctgagtgcagagtctgccttg
agtggaggctctgtcccgtcagcaagcacagcctcggaaggtgagcctgagatcctgccg
gctgaggtacaagggctaggccagcatgaggccatgcctgcacaggaggagtatacagaa
gacgactataacgagcccacagtgcactttgcagaggacacactgatccctagggaagac
ggtgaaagtgaagagggacagcctgaggctgcctggccgctgcctagtggccggcagagg
ctcatccgcaaagacacgccccactacaagaagcacttcaagatctccaagctcccacag
cctgaagctgtcgtggccctgctgcaaggggtgcagaccgacagggagggccccactgca
ggttggcacaatggcccacacacaccttgggctcctcgagcccatgaggaggaagaggag
gaggaggaggagaacagggatgaggaggaaggcgaggccaccacggaagaagatgacaaa
gaagaggctgtggcttctgctccctctgtcaagggggtgtcgtttgaccaggccaataac
ctgctgatagagcctgctcgcattgaggaggaagagttaacactcacgatcgtgcggcag
acggggggcctgggcatcagtatcgcagggggaaaaggctctaccccctacaaaggagat
gacgagggcattttcatctctcgagtgtctgaagagggccctgcagcccgtgctggagtc
cgagttggtgacaaacttcttgaggtgaatggtgtagccttgcaggacgcagagcaccac
gaggccgtggaagcacttcggggggcaggtgctgctgtgcagatgcgagtgtggagggaa
agaatggtggagccggagaacgcagtcactattacccccttacgccctgaagatgactat
agtccccgagagtggcggggaggtggcctgcgccttcccctgctccagcctgagactcct
gtatccctccgtcagcgtcatgctgcctgtctcgtgcgcagtgaaaaggggctgggcttc
agcattgctggtggaaagggctccacaccttaccgggctggtgatgggggcatctttata
tcccgcattgcagagggaggggctgctcaccgggcaggcactctacaggttggcgaccgt
gtcctctcgatcaatggagtggacatgactgaggccaggcacgaccatgctgtctccctg
ctgactgctgcttcccctaccatctccctgcttctggagagggagactggagggacttac
ccacctagccctcccccccattcctccccaacccctgctgctactgttgctgctaccgtg
agcactgctgtccccggagaacctctgctacctaggctgtcccctagcctcttggccact
gccttggaaggaccataccctgtggaggaaatctgcctgcccagggctggtggcccattg
gggcttagcattgtaggaggttctgatcactccagccacccgtttggtgtccaagatcct
ggtgtattcatctccaaggtgcttcctcggggcctagctgctcgctgtggccttcgggtt
ggggaccgcatcctagcagtgaatgggcaggatgttcgggaggccacacatcaagaggca
gtcagtgccctgctcaggccctgcctggagctgtgtctgcttgtgcggagggacccacca
cccccgggcatgcgggaactctgcatccagaaagcccctggggagaagctgggtatcagc
atccgcggaggtgccaagggtcacgcggggaacccctgtgaccctacagatgagggcatc
tttatctccaaggtgagccccacaggagctgccgggcgtgatgggcggctgcgtgtgggg
ctgcggctgctagaagtgaaccaacagagcctgctgggccttacccatgcggaagcagtg
cagctgctgcgcagcgtaggcgacacccttaccgtgcttgtctgtgatggttttgacacc
agcaccaccacagccctggaggtgtccccaggtgtcattgccaacccatttgcagcaggc
cttggccacaggaacagtctggaaagcatttcgtccattgaccgggaactgagtcctgaa
ggcccaggcaaggagaaagagttggccagtcaagccctaccctgggagtctgagtctgca
gagaccacgggtcggaatctagagcccctgaagctggactaccgtgccctggccgccctg
cccagtgctgggagtttacagagaggaccatctgcgaccaccggagggaagacgactgag
gctccctgttcccctggcagtcagcaaccaccctcccctgatgaactgccagccaatgtg
aagcaggcgtatagggcctttgcagctgtgcccaccgtgcatcctcctgagaacagtgct
acccagcctccaacacctggtcccgcagcctccccagagcagctgtccttccgtgaacga
caaaagtacttcgagctggaggtacgggtgcctcaagcagagggtcccccaaagcgtgtg
tccctggtgggtgctgatgacttgcggaagatgcaagaggaggaagctcgcaagctgcag
cagaagagggcacagatgcttcgggaagaagcagtaacctcagggcctgacatggggctc
gcctcagacagggagtccccagatgatcagcaggaggctgagcagccctgggctgtgcca
agccatgcagggggctctagcccatcatcacccccacccctgggaggcaacgcccctgtg
aggacagccaaagctgagcgacgccatcaggaacggttacgcatgcagagccccgagctt
cctgccccggaacgggccctgtctcctgcagagcgacgggctctagaggcagagaagcga
gctctgtggagggcagccagaatgaagtctctggagcaggatgctctccgtgcacagatg
gtccttagcaagtcccaggaaggccgtggcaagagaggacccttggaacggctggctgag
gccccttcacctgcccccaccccatcacccacaccattggaagacttcggcctccagacc
agtgcctcccctggacgcttgtcaccagatttcgtggaggagctgaggactttggaagca
tctcccagtcctggctcccaggaagaagatggagaagtggccttggtgctccttggcagg
ccctcacctggcgctgtgggccctgaagacatgacgctgtgcagcagccgtcggtctgtg
cggccgggacgccggggcctgggccctgtgccctcctag

DBGET integrated database retrieval system