KEGG   Mus musculus (mouse): 105787
Entry
105787            CDS       T01002                                 

Gene name
Prkaa1, AI194361, AI450832, AL024255, AMPK, AMPKalpha1, C130083N04Rik
Definition
(RefSeq) protein kinase, AMP-activated, alpha 1 catalytic subunit
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04371  Apelin signaling pathway
mmu04530  Tight junction
mmu04710  Circadian rhythm
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu05410  Hypertrophic cardiomyopathy
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    105787 (Prkaa1)
   04068 FoxO signaling pathway
    105787 (Prkaa1)
   04151 PI3K-Akt signaling pathway
    105787 (Prkaa1)
   04152 AMPK signaling pathway
    105787 (Prkaa1)
   04150 mTOR signaling pathway
    105787 (Prkaa1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105787 (Prkaa1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    105787 (Prkaa1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105787 (Prkaa1)
   04922 Glucagon signaling pathway
    105787 (Prkaa1)
   04920 Adipocytokine signaling pathway
    105787 (Prkaa1)
   04921 Oxytocin signaling pathway
    105787 (Prkaa1)
  09149 Aging
   04211 Longevity regulating pathway
    105787 (Prkaa1)
   04213 Longevity regulating pathway - multiple species
    105787 (Prkaa1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    105787 (Prkaa1)
   04714 Thermogenesis
    105787 (Prkaa1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105787 (Prkaa1)
   05410 Hypertrophic cardiomyopathy
    105787 (Prkaa1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    105787 (Prkaa1)
   04931 Insulin resistance
    105787 (Prkaa1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    105787 (Prkaa1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    105787 (Prkaa1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    105787 (Prkaa1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     105787 (Prkaa1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   105787 (Prkaa1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    105787 (Prkaa1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    105787 (Prkaa1)
  Mitophagy factors
   Other mitophagy factors
    105787 (Prkaa1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor ABC1 Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 105787
NCBI-ProteinID: NP_001013385
MGI: 2145955
Ensembl: ENSMUSG00000050697
UniProt: Q5EG47 Q3TUQ7 Q8BUX6
Position
15; 15 A1
AA seq 559 aa
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRAAIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSISNYRSCQRSDSDAEAQGKPSDVSLTSSVTSLDSSPVDVAPRPG
SHTIEFFEMCANLIKILAQ
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacggccgagaagcagaagcacgacggg
cgggtgaagatcggccactacatcctgggggacacgcttggtgtcggcaccttcgggaaa
gtgaaggtgggcaagcacgagttgaccggacataaagtggctgtgaagatactcaaccgg
cagaagattcggagccttgacgtggtgggaaaaatccgccgggagattcagaacctgaag
ctgttcaggcaccctcacatcatcaaactgtaccaggtcatcagtacaccatctgatatt
ttcatggtgatggaatatgtctctggaggagagctatttgattatatctgtaaaaatgga
aggttggacgaaaaggaaagccgccgtctgttccagcagatcctttccggtgtggattat
tgtcacaggcatatggtggtccacagagatttgaaacctgagaacgtcctgcttgatgca
cacatgaatgcaaagatagccgactttggtctttcaaacatgatgtcagatggtgaattt
ttaagaacaagctgtggctcacccaattatgccgcaccagaagtcatttcaggaagattg
tacgcaggccccgaggtggacatctggagcagcggggtcattctctatgctttgctgtgt
ggaaccctcccttttgatgatgaccatgtgccaactctttttaagaagatatgtgatggg
atcttttatacccctcagtacttaaacccttcagtaatcagccttttgaaacatatgctg
caggtggatcccatgaagagggccgcaataaaagatatcagggaacacgagtggtttaaa
caggaccttccgaagtatctctttcctgaggacccatcttatagttcaaccatgatcgat
gacgaagccttgaaagaagtgtgtgagaagttcgagtgttcggaggaggaggtcctcagc
tgcctgtacaacagaaaccaccaggacccactagccgtcgcctaccacctcatcatagac
aacaggagaataatgaatgaagccaaagatttctacctagcaaccagcccacctgactct
ttcctggacgaccaccatttaactcggcctcaccctgaaagagtaccgttcttggttgcc
gaaacaccacgggcccggcacaccctggatgaattaaacccacagaaatccaaacaccaa
ggtgtacggaaggcaaaatggcatttgggaattcgaagtcaaagccgacccaatgatatc
atggcagaagtttgtagagcaatcaagcagttggattatgaatggaaggttgtaaacccc
tattatttgcgtgtacgaaggaagaatcctgtgacaagcacattttccaaaatgagtcta
cagctataccaagtggatagtaggacttacttgttggatttccgtagtattgatgatgag
attacagaagccaaatcagggactgctactccacagagatcgggatccatcagcaactat
cgatcttgccaaaggagtgactctgatgccgaagctcaaggaaagccctcagacgtctcc
cttacctcatctgtcacctccctcgactcctcccctgtcgacgtagctccaagaccagga
agtcatacaatagaattttttgaaatgtgtgcaaatctaattaaaattcttgcacagtaa

KEGG   Mus musculus (mouse): 108079
Entry
108079            CDS       T01002                                 

Gene name
Prkaa2, 2310008I11Rik, A830082D05, AMPK, AMPKalpha2
Definition
(RefSeq) protein kinase, AMP-activated, alpha 2 catalytic subunit
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04371  Apelin signaling pathway
mmu04530  Tight junction
mmu04710  Circadian rhythm
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu05410  Hypertrophic cardiomyopathy
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108079 (Prkaa2)
   04068 FoxO signaling pathway
    108079 (Prkaa2)
   04151 PI3K-Akt signaling pathway
    108079 (Prkaa2)
   04152 AMPK signaling pathway
    108079 (Prkaa2)
   04150 mTOR signaling pathway
    108079 (Prkaa2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108079 (Prkaa2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108079 (Prkaa2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108079 (Prkaa2)
   04922 Glucagon signaling pathway
    108079 (Prkaa2)
   04920 Adipocytokine signaling pathway
    108079 (Prkaa2)
   04921 Oxytocin signaling pathway
    108079 (Prkaa2)
  09149 Aging
   04211 Longevity regulating pathway
    108079 (Prkaa2)
   04213 Longevity regulating pathway - multiple species
    108079 (Prkaa2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    108079 (Prkaa2)
   04714 Thermogenesis
    108079 (Prkaa2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108079 (Prkaa2)
   05410 Hypertrophic cardiomyopathy
    108079 (Prkaa2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108079 (Prkaa2)
   04931 Insulin resistance
    108079 (Prkaa2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    108079 (Prkaa2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    108079 (Prkaa2)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    108079 (Prkaa2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     108079 (Prkaa2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   108079 (Prkaa2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    108079 (Prkaa2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    108079 (Prkaa2)
  Mitophagy factors
   Other mitophagy factors
    108079 (Prkaa2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like ABC1 RIO1 Kdo APH TCAD9
Other DBs
NCBI-GeneID: 108079
NCBI-ProteinID: NP_835279
MGI: 1336173
Ensembl: ENSMUSG00000028518
Vega: OTTMUSG00000008125
UniProt: Q8BRK8
Position
4; 4 C6
AA seq 552 aa
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEVEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAQMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPDYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKACDIMAEVY
RAMKQLGFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDSRSYLLDFKSIDDEVVEQR
SGSSTPQRSCSAAGLHRARSSFDSSTAENHSLSGSLTGSLTGSTLSSASPRLGSHTMDFF
EMCASLITALAR
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggcgggtgaagatcggacactacgtcctgggggac
accctgggcgtcggcaccttcggcaaagtgaagattggagaacaccaattgacaggccat
aaagtggcagttaagatcttaaatagacagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaatcttaaactctttcgtcatcctcatattatcaaactctac
caggtgatcagcactccgacagacttttttatggtaatggaatatgtgtctggaggtgaa
ttgttcgactacatctgcaaacatgggcgggttgaagaggtggaagcgcgccggctcttc
cagcagatcctgtctgccgtggattactgtcacaggcatatggttgtccatagggacctg
aagccagagaatgtgctgctggatgcccagatgaacgctaagatagctgactttggacta
tctaatatgatgtcagatggtgaatttctacgaactagctgtggatcgccaaattatgca
gcacctgaggtcatctcaggaaggctgtatgcaggtcccgaggtcgatatctggagctgt
ggtgtcatcctgtatgcccttctctgtggcaccctccctttcgatgatgagcacgtgcct
acgctcttcaagaagatccgagggggtgtgttttacatcccagactatctcaaccgttct
gtcgccactctgctgatgcacatgctccaggtggaccccctgaagcgagcgactatcaaa
gacatacgagaacatgaatggtttaaacaggatttgcccagctacctatttcctgaagac
ccctcctacgatgcgaatgtcattgacgatgaggctgtgaaggaagtctgtgagaaattc
gagtgtacagagtcagaagtgatgaatagtctgtatagtggtgaccctcaagaccagctt
gcagtggcttatcatcttatcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctctagtcctccatcaggttcttttatggatgacagcgccatgcatattcct
ccaggcttgaaaccacatccagaaaggatgccgcctctcatcgcagacagccccaaagca
cgctgtccactggatgcactcaacacaacgaagcccaagtctctagctgtgaaaaaagcc
aagtggcatcttggaatccgaagccagagcaaagcgtgtgacattatggctgaagtgtac
cgagctatgaagcagctgggttttgaatggaaggtagtgaatgcataccatcttcgagta
agaagaaaaaacccagtgactggcaactatgtgaaaatgagcttacagctttacctggta
gacagtcggagctatcttctggacttcaaaagcatcgatgatgaggtggtggagcagagg
tctggttcttcaacaccccagcgctcctgttctgctgcgggcctccacagagcacggtca
agttttgattccagcacagctgagaaccactccctttctggctctctcactggctctttg
actggcagcactttgtcctcggcatccccgcgcctgggcagtcacaccatggattttttt
gaaatgtgcgccagtcttatcactgctttagctcgttga

KEGG   Mus musculus (mouse): 108097
Entry
108097            CDS       T01002                                 

Gene name
Prkab2, 5730553K21Rik, AW049591, BB124140
Definition
(RefSeq) protein kinase, AMP-activated, beta 2 non-catalytic subunit
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04371  Apelin signaling pathway
mmu04530  Tight junction
mmu04710  Circadian rhythm
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108097 (Prkab2)
   04068 FoxO signaling pathway
    108097 (Prkab2)
   04152 AMPK signaling pathway
    108097 (Prkab2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108097 (Prkab2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108097 (Prkab2)
   04922 Glucagon signaling pathway
    108097 (Prkab2)
   04920 Adipocytokine signaling pathway
    108097 (Prkab2)
   04921 Oxytocin signaling pathway
    108097 (Prkab2)
  09149 Aging
   04211 Longevity regulating pathway
    108097 (Prkab2)
   04213 Longevity regulating pathway - multiple species
    108097 (Prkab2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    108097 (Prkab2)
   04714 Thermogenesis
    108097 (Prkab2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108097 (Prkab2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108097 (Prkab2)
   04931 Insulin resistance
    108097 (Prkab2)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Other DBs
NCBI-GeneID: 108097
NCBI-ProteinID: NP_892042
MGI: 1336185
Ensembl: ENSMUSG00000038205
Vega: OTTMUSG00000029934
UniProt: Q6PAM0
Position
3; 3 F2.2
AA seq 271 aa
MGNTTSERVSGERHGAKAARAEGGGHGPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVP
WQQDLDDSVKPAQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEG
EHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDL
SSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHL
YALSIKDSVMVLSATHRYKKKYVTTLLYKPI
NT seq 816 nt   +upstreamnt  +downstreamnt
atgggaaacactaccagcgagcgggtgtccggggagcgccacggagccaaagctgctcga
gctgagggcggcggccatggcccgggaaaggagcacaagatcatggtggggagcacggac
gaccccagcgtcttcagcctgcccgactccaagctccccggggacaaagagtttgtaccc
tggcagcaggatttggatgattctgtgaagcccgcccagcaggcccggcccaccgttatc
cgctggtctgaaggaggcaaggaggtcttcatctctgggtccttcaacaattggagcacc
aagatccctctgataaagagtcataatgacttcgttgccatcctggatcttccagaggga
gagcatcagtacaagttctttgtggacggacagtgggttcatgatccgtcagagcctgtg
gttaccagtcagcttggaacaattaataacttgatccacgtcaagaaatctgattttgaa
gtatttgacgctttaaagttagactctatggaaagctcggagacgtcatgtcgagacctg
tccagctcaccccctgggccttacggtcaagaaatgtatgtgtttcgatctgaggagaga
ttcaaatccccacccatcctgccccctcacctactccaagttattcttaacaaggacacg
aatatttcatgtgacccagccttacttcctgagcccaatcatgttatgctgaaccatctc
tatgcactgtccattaaggacagtgtgatggtccttagcgcaacccatcgctacaagaag
aagtatgtcaccacgctgctgtataagcccatctga

KEGG   Mus musculus (mouse): 108099
Entry
108099            CDS       T01002                                 

Gene name
Prkag2, 2410051C13Rik, AAKG, AAKG2, AI854673, H91620p, WPWS
Definition
(RefSeq) protein kinase, AMP-activated, gamma 2 non-catalytic subunit
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04371  Apelin signaling pathway
mmu04530  Tight junction
mmu04710  Circadian rhythm
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108099 (Prkag2)
   04068 FoxO signaling pathway
    108099 (Prkag2)
   04152 AMPK signaling pathway
    108099 (Prkag2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108099 (Prkag2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108099 (Prkag2)
   04922 Glucagon signaling pathway
    108099 (Prkag2)
   04920 Adipocytokine signaling pathway
    108099 (Prkag2)
   04921 Oxytocin signaling pathway
    108099 (Prkag2)
  09149 Aging
   04211 Longevity regulating pathway
    108099 (Prkag2)
   04213 Longevity regulating pathway - multiple species
    108099 (Prkag2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    108099 (Prkag2)
   04714 Thermogenesis
    108099 (Prkag2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108099 (Prkag2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108099 (Prkag2)
   04931 Insulin resistance
    108099 (Prkag2)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 108099
NCBI-ProteinID: NP_663376
MGI: 1336153
Ensembl: ENSMUSG00000028944
Vega: OTTMUSG00000023541
UniProt: Q91WG5
Position
5; 5 A3
AA seq 566 aa
MGSAAMDTKKKKEVSSPGGSSGKKNPSLKRRSLRVHIPDLSSFAMPLLDGDVENSEKHSS
RKVDSPFSSGSPSRGLFSRGPQPRPSSPVSAPVRPKTSPGSPKTVFPFSYQESPPRSPRR
MSFSGIFRSSSKESSPNSNPSTSPGGIRFFSRSRKTSSVSSSPSTPTQVTKQHPFPLESY
KQEPERPESRIYASSSPPDTGQRFCLAFQSPARPPLASPTYHAPLRTAVLAAAPGPAEAG
MLEKLEFQEEEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRA
APLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVN
ISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQ
NLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAA
EKTYNNLDITVTQALQHRSQYFEGVVKCSKLETLETIVDRIVRAEVHRLVVVNEADSIVG
IISLSDILQALILTPAGAKQKETETE
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgggaagcgcagccatggacaccaagaagaagaaagaggtttccagcccgggcgggagc
agtggcaaaaagaaccctagcctgaagaggcggtcactgcgagtgcacattccggacctg
agttcctttgccatgccgctcctggatggagatgtggagaattcagaaaagcattcatct
cggaaggtggacagtcccttcagctcaggcagcccctccagaggactcttctccagaggc
ccccagccccggccctccagccctgtgtctgctcccgtgaggcccaagacgagccctggc
tctcccaaaactgtgttcccgttctcctaccaggagtcccctccacgctctccacgccgg
atgagcttcagtgggatcttccgctcctcatccaaagagtcttcgcccaactccaacccg
tctacctctcctgggggcatccggttcttctcacggtccagaaaaacctccagcgtctcc
tcttctccgtcaacacccacccaagtgaccaagcagcacccatttcccctggagtcctac
aagcaggagcctgaacgcccagagagccgcatctatgcttcctcgtcccctccagacact
gggcagcgcttctgcctggcctttcagagcccagcgcgacctccgctggcatccccgaca
taccatgctcctttgagaactgcggtgctggcggcggccccgggacccgcggaagccggc
atgctggagaagctggagttccaggaggaagaagactcagaaagtggcgtttatatgcga
ttcatgaggtcacacaagtgttatgacatcgttccaaccagttcaaagcttgttgtcttc
gacactacgttgcaagtcaaaaaggccttctttgccttggtagccaacggagtccgtgca
gcgccgctgtgggaaagtaaaaagcagagctttgtaggaatgctcacgattacagatttc
ataaatatcctacacagatactataaatcacccatggtacagatttatgaattggaagaa
cataagattgaaacgtggagggagttgtacttacaagaaaccttcaagcctttggtgaac
atctctccagatgcgagcctcttcgatgctgtatactcgttgatcaaaaataaaatccac
agattgccagttattgaccctatcagtgggaacgcactttatatacttacccacaaaaga
atcctcaagttcctccagctttttatgtctgacatgccaaagcctgccttcatgaagcag
aacctggatgagcttggaatcggaacgtaccacaatattgccttcattcacccagacact
cccatcatcaaagccttgaacatcttcgtggagagacggatatccgcattgcctgtggtg
gatgagtcaggaaaagttgtagatatttattccaagtttgatgtaattaatcttgctgct
gagaaaacgtacaataacttggacatcacagtgacccaggccctgcagcaccgctcgcag
tattttgagggtgtggtgaagtgcagtaagctggaaacactggagaccatcgtggacagg
atagtgagagccgaggtccatcggctggttgtagtgaatgaagcagatagcattgtgggt
attatctccctgtcagacatcctgcaagccctgatcctcacaccagcaggtgccaaacag
aaggagacagagactgaatga

KEGG   Mus musculus (mouse): 19079
Entry
19079             CDS       T01002                                 

Gene name
Prkab1, 1300015D22Rik, AU021155, E430008F22
Definition
(RefSeq) protein kinase, AMP-activated, beta 1 non-catalytic subunit
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04371  Apelin signaling pathway
mmu04530  Tight junction
mmu04710  Circadian rhythm
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    19079 (Prkab1)
   04068 FoxO signaling pathway
    19079 (Prkab1)
   04152 AMPK signaling pathway
    19079 (Prkab1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    19079 (Prkab1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    19079 (Prkab1)
   04922 Glucagon signaling pathway
    19079 (Prkab1)
   04920 Adipocytokine signaling pathway
    19079 (Prkab1)
   04921 Oxytocin signaling pathway
    19079 (Prkab1)
  09149 Aging
   04211 Longevity regulating pathway
    19079 (Prkab1)
   04213 Longevity regulating pathway - multiple species
    19079 (Prkab1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    19079 (Prkab1)
   04714 Thermogenesis
    19079 (Prkab1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    19079 (Prkab1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    19079 (Prkab1)
   04931 Insulin resistance
    19079 (Prkab1)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 DUF4758
Other DBs
NCBI-GeneID: 19079
NCBI-ProteinID: NP_114075
MGI: 1336167
Ensembl: ENSMUSG00000029513
Vega: OTTMUSG00000014718
UniProt: Q9R078 Q542K0
Position
5; 5 F
AA seq 270 aa
MGNTSSERAALERQAGHKTPRRDSSGGAKDGDRPKILMDSPEDADIFHSEEIKAPEKEEF
LAWQHDLEANDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYMSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggcaacacgagcagcgagcgcgccgcgctggagcggcaggcgggccacaagacgccg
cggagggacagctccgggggcgccaaggatggggacaggcccaagatcctcatggacagc
cctgaagacgccgacatcttccactccgaagagatcaaggctccagagaaagaggaattc
ctggcctggcagcacgacctggaagcgaatgataaagcccccgcccaggcccggcccacc
gtgtttcgatggacagggggtggaaaggaagtctacttgtctgggtccttcaacaactgg
agcaagcttcccctcacgagaagccagaataactttgtagccatcctggacctgcctgaa
ggagagcatcagtacaagttcttcgtggatggacagtggacccatgatccttctgagcca
atagtaaccagccagcttggcacagttaacaacatcattcaagtgaagaaaactgacttt
gaagtatttgatgctttaatggtggattcccaaaagtgctccgatgtgtctgagctgtcc
agctcgcccccaggaccctaccaccaggagccttacatgtctaaaccagaagagaggttc
aaagccccgcccatcctcccgccacacctgctgcaggtcatcttgaacaaggacacgggc
atctcttgtgacccagcactgcttccggagcccaaccacgtcatgctgaaccacctctat
gcactctccatcaaggatggagtgatggtgctcagtgcaacacaccggtacaagaaaaag
tatgtcaccaccctcctctacaagccgatatga

KEGG   Mus musculus (mouse): 19082
Entry
19082             CDS       T01002                                 

Gene name
Prkag1, AA571379, BB036179, Pr, Prkaac
Definition
(RefSeq) protein kinase, AMP-activated, gamma 1 non-catalytic subunit
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04371  Apelin signaling pathway
mmu04530  Tight junction
mmu04710  Circadian rhythm
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    19082 (Prkag1)
   04068 FoxO signaling pathway
    19082 (Prkag1)
   04152 AMPK signaling pathway
    19082 (Prkag1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    19082 (Prkag1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    19082 (Prkag1)
   04922 Glucagon signaling pathway
    19082 (Prkag1)
   04920 Adipocytokine signaling pathway
    19082 (Prkag1)
   04921 Oxytocin signaling pathway
    19082 (Prkag1)
  09149 Aging
   04211 Longevity regulating pathway
    19082 (Prkag1)
   04213 Longevity regulating pathway - multiple species
    19082 (Prkag1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    19082 (Prkag1)
   04714 Thermogenesis
    19082 (Prkag1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    19082 (Prkag1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    19082 (Prkag1)
   04931 Insulin resistance
    19082 (Prkag1)
SSDB
Motif
Pfam: CBS DRTGG Cbl_N3 DUF2497
Other DBs
NCBI-GeneID: 19082
NCBI-ProteinID: NP_058061
MGI: 108411
Ensembl: ENSMUSG00000067713
UniProt: O54950 Q3TWR3
Position
15 F1; 15 54.73 cM
AA seq 330 aa
MESVAAESSPALENEHFQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAF
FALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVY
LQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFIT
EFPKPEFMSKSLQELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIY
SKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLV
VVDEHDVVKGIVSLSDILQALVLTGGEKKP
NT seq 993 nt   +upstreamnt  +downstreamnt
atggagtcggttgctgcagagagctcgccagctctagagaatgaacactttcaagagacc
ccggaatcaaacaatagtgtgtatacttccttcatgaagtctcatcgctgctatgaccta
attcccacaagttccaagttggtggtatttgacacttcgctacaggtaaagaaagccttt
tttgccctggtgaccaatggtgttcgtgccgcccctttgtgggacagtaagaagcagagt
tttgtgggcatgctgaccatcaccgacttcatcaacattttgcaccgatactataagtca
gccctggtgcagatctacgaactggaggagcacaagatagagacgtggagagaggtgtac
ctgcaggactcctttaagccacttgtctgcatctctccaaatgccagcttgtttgatgct
gtctcttcattaattcgaaataagatccacaggctcccagttatcgacccagagtcaggc
aacaccttgtacatccttactcacaagcggatcctcaagttcctcaagttgtttatcacc
gagttccccaagccggaattcatgtctaagtctctccaagagctgcagattggcacctat
gccaatattgccatggtccgtactaccacgcctgtctacgtggctctgggcatctttgta
cagcaccgagtctccgccttacctgtagtggatgagaaagggcgtgtggtggacatctac
tccaagtttgatgtgatcaatttggcagccgaaaagacctacaacaacctagatgtgtct
gtgacaaaagccctgcagcatcggtcccactactttgagggtgttctcaaatgctacctg
catgagactctggaaaccatcatcaataggctggtggaggcagaggttcaccgtctggtg
gtggtggatgaacacgacgtggtcaagggcatcgtttcgctgtctgacatcttacaggct
ctggtgctcacgggtggagagaagaagccctga

KEGG   Mus musculus (mouse): 241113
Entry
241113            CDS       T01002                                 

Gene name
Prkag3, AMPK, AMPKg3L, AMPKg3S, Amkg3, Ampkg3
Definition
(RefSeq) protein kinase, AMP-activated, gamma 3 non-catalytic subunit
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04371  Apelin signaling pathway
mmu04530  Tight junction
mmu04710  Circadian rhythm
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    241113 (Prkag3)
   04068 FoxO signaling pathway
    241113 (Prkag3)
   04152 AMPK signaling pathway
    241113 (Prkag3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    241113 (Prkag3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    241113 (Prkag3)
   04922 Glucagon signaling pathway
    241113 (Prkag3)
   04920 Adipocytokine signaling pathway
    241113 (Prkag3)
   04921 Oxytocin signaling pathway
    241113 (Prkag3)
  09149 Aging
   04211 Longevity regulating pathway
    241113 (Prkag3)
   04213 Longevity regulating pathway - multiple species
    241113 (Prkag3)
  09159 Environmental adaptation
   04710 Circadian rhythm
    241113 (Prkag3)
   04714 Thermogenesis
    241113 (Prkag3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    241113 (Prkag3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    241113 (Prkag3)
   04931 Insulin resistance
    241113 (Prkag3)
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 241113
NCBI-ProteinID: NP_714966
MGI: 1891343
Ensembl: ENSMUSG00000006542
Vega: OTTMUSG00000034607
UniProt: Q8BGM7
Position
1; 1 C4
AA seq 489 aa
MEPELEHTLPGTLTWSHSGGPESQEMDFLEQGENSWPSPAVATSSERTCAIRGVKASRWT
RQEAVEEAEPPGLGEGAQSRPAAESTRQEATFPKATPLAQAVPLAEAETSPTGWDLLLPD
CAASAGGSSTGDLELTIEFPAPEAWDCELEGLGKDRPRPGPSPQAPLLGLSWDDELQKPG
AQVYMHFMQEHTCYDAMATSSKLVIFDTTLEIKKAFFAMVANGVRAAPLWDSKKQSFVGM
LTITDFILVLHRYYRSPLVQIYEIEEHKIETWREIYLQGCFKPLVSISPNDSLFEAVYAL
IKNRIHRLPVLDPVSGTVLYILTHKRLLKFLHIFGALLPRPSFLCRTIQDLGIGTFRDLA
VVLETAPVLTALDIFVDRRVSALPVVNESGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEA
LRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLS
PAGIDALSA
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggagcccgagctggagcacacattgcctgggaccctgacctggagccacagtgggggt
ccagagagtcaagagatggacttcttagaacaaggagaaaactcatggccctcaccagct
gtggccaccagctcagaaagaacctgtgccatacggggagtcaaggcttccagatggacg
agacaggaggccgtagaggaagcagaaccaccaggtttgggagaaggtgcccagtccaga
ccagctgctgagtccaccaggcaggaggccacattcccgaaggccacacccttggctcaa
gctgttcccttggctgaagcggagacctcccccacagggtgggacctgctcttgcccgac
tgtgcagcctcagcagggggctccagcacaggtgacctggagctgaccatagagttccca
gccccagaggcctgggactgtgagctggaaggcctggggaaggacaggcctcgtcctggt
ccatccccacaggccccacttctcggcctgagttgggatgacgaacttcagaagcccgga
gcccaggtctacatgcacttcatgcaggaacacacctgttatgatgccatggctaccagc
tccaaattggtcatctttgacaccacgttggagataaagaaggctttctttgccatggtg
gccaacggtgtgagggcagctcctctgtgggacagcaagaagcagagctttgtgggtatg
ctcaccatcactgactttatcctggtgctgcaccggtactacagatcccccctggtccag
atctatgagattgaagaacataagattgagacctggagggagatctacctacaaggctgc
ttcaagcctctagtctccatctctcccaatgacagcctgtttgaagctgtctatgccctc
atcaagaaccgaatccaccgcctgccggtcctggacccggtctctggcactgtgctctac
atactcacacacaagcggctactcaagttcctgcatatatttggtgccctgttgccccgg
ccctccttcctctgccgcactatccaagacttgggcatcggcacattccgagatttggct
gtagttctggaaacagctcctgtcctgactgcgctggacatctttgtggaccgacgtgtg
tctgcactgcctgtggtcaatgaatctggtcaggtcgtgggcctctactcccgctttgat
gtcattcacctggctgcccagcaaacctacaaccacctagacatgagtgtgggagaagct
ctgagacagaggacactgtgtctggagggagttctctcctgccagccccacgagagccta
ggtgaagtcattgacaggatcgcacgggaacaggtgcataggctggtgttggtggatgag
acccagcatcttctgggcgtggtctccctctctgacatacttcaagcactggtactcagc
cctgctggcatcgatgccctcagcgcctga

DBGET integrated database retrieval system