KEGG   Mus musculus (mouse): 105827
Entry
105827            CDS       T01002                                 

Symbol
Amigo2, AI415330, AMIGO-2, AW208913, Ali1
Name
(RefSeq) adhesion molecule with Ig like domain 2
  KO
K22529  amphoterin-induced protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    105827 (Amigo2)
SSDB
Motif
Pfam: LRR_8 LRR_4 ig LRR_5 Ig_3 LRR_9 I-set LRRNT Ig_2 V-set
Other DBs
NCBI-GeneID: 105827
NCBI-ProteinID: NP_001158035
MGI: 2145995
Ensembl: ENSMUSG00000048218
UniProt: Q80ZD9 Q4VBE6
Position
15:complement(97141955..97145168)
AA seq 519 aa
MSLRFHTLPTLPRAVKPGCRELLCLLVIAVMVSPSASGMCPTACICATDIVSCTNKNLSK
VPGNLFRLIKRLDLSYNRIGLLDADWIPVSFVKLSTLILRHNNITSISTGSFSTTPNLKC
LDLSSNRLKSVKSATFQELKALEVLLLYNNHISYLDPAAFGGLSHLQKLYLSGNFLTQFP
MDLYTGRFKLADLTFLDVSYNRIPSIPMHHINLVPGRQLRGIYLHGNPFVCDCSLYSLLI
FWYRRHFSSVMDFKNDYTCRLWSDSRHSHQLQLLQESFLNCSYSVINGSFHALGFIHEAQ
VGERAIVHCDSKTGNGNTDFIWVGPDNRLLEPDKDMGNFRVFYNGSLVIENPGFEDAGVY
SCIAMNRQRLLNETVDIMINVSNFTINRSHAHEAFNTAFTTLAACVASIVLVLLYLYLTP
CPCKCKAKRQKNTLSQSSAHSSILSPGPTGDASADDRKAGKRVVFLEPLKDTAAGQNGKV
KLFPSETVIAEGILKSTRAKSDSDSVNSVFSDTPFVAST
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgtcgttaaggttccacacactgcccaccctgcctagagctgtcaaaccgggttgcaga
gagctgctgtgtctgttggtgatcgcagtgatggtgagccccagcgcctcaggaatgtgc
cccactgcttgcatctgtgccaccgacattgtcagctgcaccaacaaaaacctatctaag
gtgcccgggaaccttttcagactgattaaaagactggatctgagctataacagaatcgga
ctgttggatgccgactggatcccggtgtcgtttgtcaagctgagcaccttaattcttcgc
cacaacaacatcaccagcatctccacgggcagtttctccacaaccccaaatttaaagtgt
ctggacttatcatccaataggctgaagtcggtaaagagtgccacattccaagagctgaag
gctctggaagtactgctgctgtacaacaaccacatttcctatctggaccccgcagcgttc
ggggggctttcccacttgcagaaactctatctgagtgggaactttctcacacagttccct
atggatttgtatactgggaggttcaagctggctgatctgacatttttagatgtttcctat
aatcgaatcccttccataccgatgcaccatataaacttagtgccggggagacagctgaga
ggcatctaccttcacgggaacccatttgtatgtgactgttctctgtactcgttgctgatc
ttttggtaccgtaggcactttagctccgtgatggattttaagaatgactatacctgtcgc
ctgtggtctgactccaggcactcccaccagctgcagctgctccaggagagctttctgaac
tgttcttacagcgttatcaacggctccttccacgcacttggctttatccacgaggctcag
gttggggagagggcgatcgtccactgtgacagcaagactggcaatggaaatactgatttc
atctgggtcggtcccgataacaggctgctggagccagataaagacatggggaactttcgt
gtgttttacaacggaagtctggtcatagagaaccctggctttgaggacgccggggtatat
tcttgtatcgcaatgaacaggcagcggctgttaaacgagacggtggatatcatgatcaac
gtgagcaatttcaccataaacagatcccacgcccacgaggcgtttaacacggcctttacc
accctggctgcctgcgtggccagtatagttctagtgctactgtatctgtacctgacgccg
tgcccatgcaaatgcaaagccaagagacagaaaaacacgctgagccaaagcagtgcccac
tcgtccattctcagtcctggccccactggcgatgcctctgctgacgatcggaaggcaggt
aaaagagtcgtgtttctggagcccctgaaggacacggcggccggacagaatggcaaagtc
aagcttttccccagtgagaccgttatagccgagggcatcttaaagtccaccagggcaaag
tctgactcagactcagtcaattccgtgttctcagacacaccctttgtggcatccacttag

DBGET integrated database retrieval system