KEGG   Mus musculus (house mouse): 105835
Entry
105835            CDS       T01002                                 
Symbol
Sgsm3, 1810012I01Rik, Cip85, RUSC3, Rutbc3
Name
(RefSeq) small G protein signaling modulator 3
  KO
K20176  small G protein signaling modulator 3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    105835 (Sgsm3)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    105835 (Sgsm3)
SSDB
Motif
Pfam: RabGAP-TBC RUN SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 105835
NCBI-ProteinID: NP_598852
MGI: 1916329
Ensembl: ENSMUSG00000042303
Position
15:80861966..80896491
AA seq 750 aa
MSGNHTPSASGPFSALTPSIWPQEILAKYSQKEESSEQPELCYDEFGFRVDKEGSEPGCS
QMTGSPLVEDPPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGIPHGMR
PQLWMRLSGALQKKKNSELSYREIIKNSSNDETIAAKQIEKDLLRTMPSNACFANVNSIG
VPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMCAIIEDLLPASYFSTT
LLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIRLLLRIWDL
FFYEGSLVLFQTTLGMLRLKEEELIQSENSASIFNTLSDIPAQMDDAELLLGEAMRLAGS
LTDVAVETQRRKHLAYLIADQGQTLGTGTTTNLSQVVRRRTQRRKSGITSLLFGEDDLEA
LKAKNIKQTELVADLREAILRVARHFQCTDPKNCSVELTPDYSMESHQRDHENYVACLRS
HRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEVLDER
SKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREV
ERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLICV
GLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWELP
ARREEEKQPLKEGVQDMLVKHHLFSWDIDG
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgtcaggaaaccacacgccttctgccagtggccctttctctgccctgactccaagcata
tggccccaggagatcctggcaaaatactcacagaaagaagaatcctcagagcagccagag
ctctgctatgatgagtttggtttccgtgtggacaaggaaggttctgagcctggatgcagc
cagatgacaggctcacccctggtggaggaccccccgcagaggctacgttggcaggctcac
ctggagttcacccataaccatgatgttggggatctcacctgggacaagattgcagtctcc
ctcccccgctctgagaaactccgttccctagtgctggctggcatcccacatggcatgagg
ccacagttgtggatgcggctctctggggcgctgcagaagaagaagaactctgagttgtcc
taccgtgagattataaagaacagctccaacgatgagaccatcgctgccaaacagatcgaa
aaggacctgctccgtaccatgcccagcaacgcctgctttgccaatgtgaacagcatcggt
gttccccgcctgcgcagagtcctccgagcactggcctggctctacccagagattggctac
tgccagggcacaggcatggtggctgcttgtctcctgctgttcctggaggaggaggatgcc
ttctggatgatgtgtgccattattgaggacctgctgcctgcctcctacttcagcactacc
ctgctgggagtccagactgaccagcgggtcctgcgccacctgattgtccagtacctgcct
cgcttagacaaactgttgcaggagcacgacattgagctgtctcttatcacgctgcactgg
ttcctcacggccttcgccagcgtggtgcacatcagactgctgctgcgcatctgggacctg
tttttctacgagggctccctggtgttgttccagactacgctgggcatgctgcgccttaag
gaggaagagctgatacagtctgagaactcagcttccatcttcaacacgctgtcagacatt
cctgcacagatggatgacgcagagctgctgctgggggaggccatgaggctggctggctcc
ctcactgatgtggccgtggagacccagcgtcgcaagcacctggcctaccttattgcagac
caaggccaaaccctggggacgggcaccaccactaacctctctcaggttgtacggcgcagg
acgcagcggaggaagtctggtatcacttccctgctttttggagaggacgacctagaagct
ctcaaggcaaagaacatcaagcaaacagagctggtagccgaccttcgcgaagccattttg
cgtgtggcacgccacttccagtgcacagaccccaagaactgtagtgtggagctgacccca
gactacagcatggagagccaccagcgggaccatgagaactacgtggcatgcttacgcagc
caccggcgccgggccaaggccctgctggactttgagcggcacgatgatgatgagctaggc
ttccgcaaaaatgacatcatcacgatcatttcccagaaggatgagcactgctgggtgggt
gagctgaacggcctgagaggctggtttccagccaagtttgtggaggtcctggatgagcga
agcaaagagtactccattgcgggggacgactctgtgacagaaggagtaacagacctcgtg
cgaggaaccctctgcccagccctcaaggccctgtttgaacacggattgaagaagccatcc
ttgcttggaggggcttgtcacccctggctgtttatcgaggaggcagcgggccgtgaagtc
gaaagagactttgattctgtgtactcccgcctggtgctctgtaagacatacaggctggac
gaagatggcaaagtcctgacccctgaagagctgctgtaccgggcagtgcagtctgtgaat
gtgacccatgatgcagcacacgcacaaatggatgtcaagctccgctcacttatctgcgtg
gggctaaatgaacaggtcctacacctgtggctggaggttctctgctccagcctgcccact
gtggagaagtggtaccagccctggtccttcctgcgaagccctggctgggtccagatcaag
tgtgagctccgtgtcctctgctgctttgccttcagcctctcccaggactgggagctccct
gctaggagagaggaggaaaagcagcccctgaaggagggtgtgcaggacatgctggtgaag
caccatctcttcagctgggacatagatggatga

DBGET integrated database retrieval system