KEGG   Mus musculus (house mouse): 105837
Entry
105837            CDS       T01002                                 
Symbol
Mtbp, AI429604, MDM2BP
Name
(RefSeq) Mdm2, transformed 3T3 cell double minute p53 binding protein
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: MTBP_mid MTBP_C MTBP_N
Other DBs
NCBI-GeneID: 105837
NCBI-ProteinID: NP_598853
MGI: 2146005
Ensembl: ENSMUSG00000022369
UniProt: Q8BJS8
Position
15:55420800..55489819
AA seq 894 aa
MDRYLLLVTWREGKFRSVAGGEIEPGTEATSLESTDKQPDLTATNIYHLLKRSISDSIHP
DDSTFPACSVGGTPHSRKWFFAVQAICGFYQFCSSDWQEIHFDAEKDKIEDVLQANIEEC
QSAVECFEEDDSNSRESLPLADLYEESAENLHQLSDKLPAPGRAMIDIILLPSDKDPPKL
KECLPIVGALKHLKEWHSAKVIIAGSYCEINCQKIAEYLSASVVPLEEFRNAIDPRELWR
GEIQMRERKFGFEISFPEFCLKGVTPTNVSAYNLNTCFLAKKIASSKVFHYYGPALEFVQ
MIKLSDLPSCYMSDIEFELEVTGHCTRQNSMLLLEQISSLCGKVGALFVLPCTVSNVLIP
PPSQLASRKWKEYMAKKPKTISVPDVAVKGEFSGYHLLLQGMGKRKCRATLLHSASQING
SFALSVIHGKMKTKAGEARPSFPFDFSSLPRFSEEQVLQREKQLASFQVLALKECLKRRK
AANQPEAFSADELKSLLALTRERFLGHFDVLPTEAALAQTDTVKAAGVVNDDGTVEPYSS
SLMETNPLEWPERHVLQNLETSEKAKQKMRTGSLPRSSEQLLGHKEGPRDSLTLLDAKEL
LKYFTSDGLPVGDLQPLHIQRGEKPFVLTPELSPGKLQVLPFEKASECHYHGIEYCLDDQ
KALERDGGFSELQSRLIRYETQTTCTRDSFPVPTVLSPLPSPAVLSEPQSVPEGEALQGE
LRTEVSGLKRRSKDPSCLYPQKRLTRSESSDCLPSQASCNSNHHHHTGKPRKPQAERCVS
GLPLPGREASKDTSKTSSGQKRAHESKSSKQMKESRSQKHTRMLKEVVKDTLKRHHITEA
HESFTACSQRLFDISKFYLKDLKTSRGLFEEMKKTANNNVVQVIEWVVEKMSKK
NT seq 2685 nt   +upstreamnt  +downstreamnt
atggatcggtacttgctgctggtcacctggagggaagggaagtttcgatccgtggcgggt
ggggagatcgagcctggcactgaggcgacatccctggagagcaccgacaaacagcccgat
ttgaccgcaaccaatatttatcacctcttgaagagaagcatcagcgattcaatccatcca
gatgacagtacattccctgcttgttcagtgggtggcacacctcattccaggaagtggttc
tttgcggtgcaagcaatatgcggattttaccagttttgtagttctgattggcaagagata
cattttgatgctgaaaaagataaaatcgaagatgttcttcaagcaaatatagaagaatgt
cagagtgctgttgagtgttttgaagaagatgacagtaatagcagggaatccttacccttg
gctgacctatatgaagaatcagcagaaaatttgcatcagttatcagacaagcttcccgct
cctggtagagcaatgatagacataatactgttgccttctgacaaagaccctcctaagcta
aaagagtgcttgcccattgtaggggccttgaaacatctgaaggaatggcattcagcaaaa
gttatcatagcaggaagttactgtgagataaattgtcagaaaattgctgaatacctttca
gctagtgttgtgcctttagaagaattcagaaatgccattgatccgagggaactgtggcgg
ggagagattcagatgcgggaacgaaagtttggatttgaaattagttttcctgaattttgt
ttaaaaggagttacgcctacgaatgttagtgcgtataatttaaatacctgcttccttgcc
aagaagatagcatcttctaaggttttccattattatggtcctgctttggaatttgtgcag
atgataaaactatcagatcttccctcctgttacatgtcggatatcgagtttgagttagag
gtgactgggcactgcacgaggcagaattccatgctgctgttggaacagatctcttccctg
tgtggcaaggttggtgctctctttgtgctgccgtgtactgttagcaatgtactcatccca
cctcccagccaactggcctcaagaaagtggaaggaatacatggctaagaagcccaagacc
atcagtgttcccgatgttgccgtgaagggagagttttctggctatcatctcctgctgcaa
ggtatgggcaagagaaaatgcagagccaccctgctgcactcggccagccagatcaatggc
tcgtttgcactcagtgtcattcatgggaagatgaaaacaaaggcaggagaagccagaccg
agtttcccctttgacttctcgtcactcccaaggttttcggaggagcaggttttacagaga
gagaaacaattagccagctttcaagttttggctttgaaagaatgcctgaaaagaagaaag
gctgcaaaccagcccgaagccttttctgccgatgaactcaaaagtctgttggcactcacg
agggagcgcttcctaggtcactttgatgttctccccactgaagcagctttagcacaaaca
gacaccgtgaaagctgccggcgtggtaaatgatgacggtacagttgaaccttattcttca
agcctaatggaaaccaatcctctggaatggccagaaagacatgttcttcagaatttagaa
acttctgaaaaagctaaacaaaaaatgagaactggctcattaccgcgttcgtctgaacag
ttgctgggccataaagagggtccccgggactcactcacattactggatgctaaggagctg
ctgaagtatttcacctcggatgggttaccagtcggagatcttcagccgttacacattcaa
cggggggaaaagccttttgttttgacaccagagcttagtcctggaaaacttcaggtctta
ccttttgaaaaagcctcggaatgccattaccacgggattgaatattgcctggatgaccaa
aaagctttagaaagagatgggggattttctgaacttcagtcgcgccttattcgttacgag
acgcagaccacctgcaccagagacagttttccagtccccaccgtgctgagccctcttcca
tcccctgcagttctgtcagagcctcagagtgtccccgaaggagaagcactgcaaggcgaa
ctgaggactgaagtttctggattgaagcggagatctaaagaccccagctgcctgtacccc
cagaaaagacttacgagatcagaaagttctgattgtttgccttcccaagcgagttgcaat
agtaatcatcaccatcacacagggaaacccaggaagcctcaggcagagcgctgtgtgtca
gggcttcctctgcctggccgggaagcttccaaagatacctcaaagaccagttcaggacaa
aaacgagcacacgaatcaaaatcatcaaagcaaatgaaggaatcacggtcccagaaacac
acacggatgctgaaggaggtggtaaaagacaccttgaagaggcaccacatcacggaggcc
catgagagcttcacggcctgcagccagagactcttcgacatctccaagttctacctgaag
gatctgaaaacatcaaggggtctctttgaagaaatgaagaaaacagccaacaacaatgtg
gtgcaggtgatcgaatgggtggtagaaaagatgagcaagaaataa

DBGET integrated database retrieval system