KEGG   Mus musculus (mouse): 105844Help
Entry
105844            CDS       T01002                                 

Gene name
Card10, AI449026, Bimp1, Carma3
Definition
(RefSeq) caspase recruitment domain family, member 10
  KO
K20912  caspase recruitment domain-containing protein 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    105844 (Card10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD CARD_2 DinB_2 BLYB Mit_KHE1
Motif
Other DBs
NCBI-GeneID: 105844
NCBI-ProteinID: NP_570929
MGI: 2146012
Ensembl: ENSMUSG00000033170
Vega: OTTMUSG00000035247
UniProt: P58660 E9PUV9
Position
15; 15 E1
AA seq 1070 aa AA seqDB search
MLGGPGGRRAGGGANDPEGTAPSRLRSRRPSTEPGAQGSCSARGSEDAAMQGRADAGEAD
EEAGAGSGSEAEEDALWERIEGVRHRLTRALNPAKLTPYLRQCRVLDEQDEEEVLSTYRF
PCRANRTGRLIDILRCRGKRGFEAFLEALEFYYPEHFTLLTGQEPAQRCSMILDEEGPEG
LTQFLMTEVRRLREARKSQLHREQQLQARGRALEEERAGLEQRLREQQQAQERCQRLRED
WEAGSLELLRLKDENYMIAMRLAQLSEEKNSAVLRSRDLQLAVDQLKLKVSRLEEECALL
RRARGPPPGAEEKEREPDGADLLSELRAENQRLTASLQELQEGLQQEMSRPGAAGSERIL
LDILEHDWREAQDSRQELCQKLHAVQGELQWAEELRDKYLQEMEDLRLKHRTLLKDCDLY
KHRMATVLAQLEEIEKERDQAIQSRDRIQLQYSQSLIEKDQYRKQVRGLEAERDELLTTV
TSLEGTKAMLEAQLQRTQGGSCLKACASSHSLCSNLSSTWSLSEFPSPLGGPEATGEAGG
SEPHTSEEATDSEKEINRLSILPFPPSAGSILRRQREEDPEPPKRSFSSMSDITGSVTLK
PWSPGLSSSSSSDSVWPLGKPEGLLARGCGLDFLNRSLAIRVSGWSPPAGLDPQDKSPDS
MPGLGDRWSGAVVRRVLSGPGSARTEQKEPRAEGTGLEGAGLEAEAQQRTLPWNQSSTLP
FLLDSKACHSFHEALDAWAKGPGAEPFYIRANFSLPERSDPHALCVKAQEILRLVDPAHK
RRQEWFCTRVDTLTLRDLDRGTVPNYQRAQQLLEVQEKYLISSRHRSPRSNLKKRALGLV
RPKPAGGTAGDSAEQLPAEPCSELERSLKPYSLVRPLLVSALRPVVLLPECLAPRLIRNL
LDLPSSRLDFQVCPAESLSGEEQCTSSAPGAPKAWPATAGLGSRIRAIQESVGKKHCLLE
LGARGVRELVHSEVYPIVIHVEVTEKNVREIRGLLGRPGWRDSELLRQCRGSEQWLWGLP
CSWVQVPAHAWGHAEELAKVVRGRILQEQARLVWVERGSSRGGSGSSSEA
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgttgggtggcccgggaggccgccgggctgggggcggagccaatgaccccgaaggcacc
gccccgtcgcgcctccggagccgtcggccgagcacagagccgggagctcagggcagctgc
agcgcccgtggctcggaggacgcggccatgcagggccgggcggacgcgggcgaggctgac
gaggaggctggggcgggttcggggtcggaggccgaagaggacgcgctgtgggagcggatc
gagggcgtccggcaccgactgacgcgcgccctgaatccggccaagctcacgccgtatctg
cgccagtgccgcgtcctggacgaacaggacgaggaggaggtgctcagcacctaccgtttc
ccgtgccgcgctaaccgtaccgggcgcctcatagacattttacgctgccggggcaagagg
ggcttcgaggccttcctggaagccctggaattctactacccagaacacttcacgctgctc
actggccaggaacctgcccaacgctgctccatgatccttgatgaggagggtcccgagggc
ctgactcagttcttgatgactgaggtccggaggcttcgggaagctcggaagagccaattg
caccgagagcagcaactgcaggcccggggccgggccctggaggaggagcgggcagggcta
gagcagaggcttcgggagcagcagcaggcacaggagcgctgccagcgactgcgggaggac
tgggaggctggcagcctggagctgctgcgcctcaaggatgagaactacatgatcgccatg
cgcctggctcagctcagcgaggagaagaattcggctgtgctgcgcagccgagacctgcag
ctggcggtggaccagctcaagctcaaggtcagccggctggaggaagagtgtgcgctgctg
aggagggccaggggcccaccgcctggggctgaggagaaggagagggagccagatggcgct
gatcttctctctgagcttcgtgcagagaaccagcggctgacggcttcactgcaggagctt
caggaaggtcttcagcaggagatgagccggccaggagctgcaggctctgaacgtatccta
ctggacatactggagcacgactggagggaggcgcaggacagcaggcaggagctgtgtcag
aagcttcatgctgtgcagggcgagctacagtgggcagaggagctgcgggacaagtacctg
caagagatggaggatctgcggctcaaacatcgaacgctgctgaaggactgtgacctctat
aagcaccgcatggccactgtgttggcccagctggaggagattgagaaagagcgggaccag
gcaatccagagccgagaccggatccagctgcagtattctcagagcctcattgagaaggac
cagtaccgcaagcaggtgcgggggctggaggcggagcgcgatgagctgctcaccacagtc
accagcctggaggggaccaaggccatgctggaggcacagctgcagcggacacaggggggt
tcctgtctcaaggcctgtgcctcctcccactccctgtgctccaacctcagcagcacctgg
agcctcagcgagttcccatcgcccctgggaggcccagaagctacaggagaagccggggga
tctgagccccacacctcggaggaagccacagacagcgagaaggagatcaaccggctctct
atcctgcctttcccacccagtgctggttccatactccgccggcagcgtgaggaagacccg
gagccccctaagaggtcttttagcagcatgtcggatatcacagggagtgtgacccttaag
ccatggtcccctggcctctcttcatcatcctcgtctgacagtgtgtggcctttgggaaag
ccggaaggcctcctggctcggggctgtggcctggacttcctcaataggtctctggccatc
cgagtgtccggctggagtccccccgcaggcctggatccccaggataagagtccagatagc
atgccgggccttggagacaggtggtctggggcggtggtgcgaagggtgttgtctgggcct
gggtcagccaggacagaacagaaagagccgagggcggaaggcactggtctggagggggca
ggcctggaagcggaggcccagcagaggaccttgccctggaaccagagctccaccctcccc
ttcctgctggactcaaaggcctgtcattccttccatgaggccctggatgcctgggcaaag
ggaccgggtgccgagcccttctacattcgagccaacttctccctgcccgagcggtcggat
ccccatgccctttgtgtgaaagcccaagagatcctgcggttggtggacccagcccacaag
cggaggcaggagtggttctgtactcgagtggacaccctcaccttacgggacctggaccgg
ggcaccgtgcccaattatcagagagctcagcagctcctagaagtccaggaaaaatacttg
atctccagcagacaccgaagtcctcgaagcaacctgaagaagcgagccctagggttggtg
aggcccaagcctgcagggggcactgcaggagactcagcagaacagctccctgcagagccc
tgctcagagctagaacgaagcctaaaaccctacagcctggtgcgaccgctgttggtgtct
gccttgaggcctgtggtcctcctgcctgagtgcctggcgcctcgcctcatccgtaacctg
ctggatctgccaagctccaggctggatttccaagtgtgcccagcagagagcctctctggg
gaggaacagtgtacgtcctcagctcccggagcccccaaagcctggccggccactgctggg
ctaggcagcaggatccgtgccatccaggagtctgtcgggaagaagcactgcctgttggag
ctgggtgcacggggagtgcgggagttggtgcacagcgaggtctaccccattgtcatccac
gtggaggtgactgagaagaatgtccgtgagatcaggggcctgttgggccggccgggctgg
cgggattcagaactgctccgtcagtgtcggggctcagaacagtggctctggggactgccg
tgttcctgggtgcaggtgcctgcgcatgcgtggggccatgcagaggagctggccaaggtg
gtgcgtggccgaatcttgcaggaacaggctcgccttgtgtgggtggagcgaggcagcagc
agagggggcagtggcagcagtagtgaggcctga

DBGET integrated database retrieval system