KEGG   Mus musculus (mouse): 105855
Entry
105855            CDS       T01002                                 

Gene name
Nckap1l, 4930568P13Rik, AI463083, Hem1, Hemp1
Definition
(RefSeq) NCK associated protein 1 like
  KO
K05750  NCK-associated protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04810  Regulation of actin cytoskeleton
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105855 (Nckap1l)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105855 (Nckap1l)
SSDB
Motif
Pfam: Nckap1
Other DBs
NCBI-GeneID: 105855
NCBI-ProteinID: NP_705725
MGI: 1926063
Ensembl: ENSMUSG00000022488
UniProt: Q8K1X4
Position
15; 15 F3
AA seq 1134 aa
MSLTSAYQLKLAEKLTILNDRGQGVLIRMYNIKKTCSDSKSKPPFLLEKSMESCLKYINK
KFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFD
INLNFDFTRSYLDLIVTYTSVILLLSRIEDRRILIGMYNCAHEMLHGHSDPSFARLGQMV
LEYDHPLKKLTEEFGPHTKAVSGALLSLHFLFVRRNQGAEQWRSAQLLSLISSPPAMINP
ANSDTMACEYLSVEVMERWIIIGFLLCHGCLNSNSQCQKLWKLCLEGSLYITLIREDVLQ
VHKVTEDLFSSLKGYSKRVADIKESKEHAITNSGQFHCQRRQFLRTAVKELETVLNDEPG
LLGPKALFAFMALSFIRDEVTWLVRHTENVTKTKTPEDYADSSIAELLFLLEEIRALVRR
HIKVIQQYHLQYLARFDVLVLSDIIQNLSVCPEEESVIMSSFVSILSSLNLKQVDNEEKF
DFSGLRLDWFRLQAYTSVSKAPLHLHENPDLAKVMNLIIFHSQMLDSVEKMLVETSDLST
FCFHLRTFEKMFATTLEEPTMLRYTIAFPLICAHFVHCVHEMCPEEYPHLKNHGLHHCNS
FLEDLAKQTSNCVLEICAEQRNLNEQLLPKHCATTISKAKNKKSMKQRQAPRKGEPERDK
PGAESHRKNRSLVTNMDKLHLNLTELALAMNHVHSFSVFEHTIFPSEYLSSHLEARLNRA
IVTLAGYNATTQEILRPSELLAGVKAYISFIQSLAQFLGADASRIVRNALLQQTQPLDSS
GEQTVTTLYTNWYLESLLRQASSGAIVLSPAMQAFISLPRDGEQNFSAEEFSDISEMRAL
AEILGPYGMKFLSENLMWHVTSQIVELKKLVVENMDILVQIRSNFSKPELMASLLPQLTG
AENVLKRMTIIGVILSFRAMAQEGLQEVFSAHCPFLMGPIECLKEFVTPDTDIKVTLSVF
ELACAAGVSCDIDPALVAAIANLKADNSSPEEEYKVACLLLIFLAVSLPLLATDPSSFFS
IEKDGYNNNIHCLTKAIIQVSAALFTLYNKNIETHLKEFLVVASVSLLQLGQETDKLKTR
NRESISLLMRLVVEESPFLTLDMLESCFPYVLLRNAYREVSRAFYLNRLPASSH
NT seq 3405 nt   +upstreamnt  +downstreamnt
atgtctttgacctctgcctatcagcttaaattagcagagaagctcacgatcctgaatgac
cgaggacagggagttctcatccgcatgtacaacatcaagaagacctgttcagattcaaaa
tccaagccaccttttttactggaaaagtccatggaatcatgtctcaagtacatcaacaag
aagtttcccaacatagatgtccgaaatagcacgcaacatttaggaccagtgcatcgtgaa
aaagctgagataattagattcctcactaactattaccagtcatttgtggatgtcatggaa
tttcgggatcatgtatatgaacttctcaacaccattgatgcctgccagtgtcattttgat
attaatctcaactttgacttcactcggagctacctggacttaattgtgacgtacacctca
gtcattttactcctgtcacggattgaggaccgcaggatactcattggcatgtacaactgt
gcccatgagatgctgcatgggcacagtgaccccagttttgctcgcctgggccagatggta
ttagagtatgaccatcctctgaagaagctgacagaagaatttggacctcacacaaaggct
gtgagtggagccctgctctctctgcacttcctctttgttcggaggaaccagggagctgag
cagtggcgcagcgcccagcttctaagcctcatcagcagccccccggccatgattaaccct
gctaattcagacacaatggcctgtgagtatctgtccgtggaagtgatggagcgatggatc
ataattgggtttcttctttgccatgggtgcctcaactccaacagccagtgccagaagctg
tggaagctgtgtctggagggttccctgtacatcacgctcatccgggaagatgtgctgcaa
gtgcacaaggtcaccgaggacctgttcagcagtttgaaagggtacagtaagcgagtggca
gacatcaaggagagcaaggaacacgccattacaaacagtggccagtttcactgtcaacgc
cggcagtttctgcggacagctgtgaaggagttggagactgtgttaaatgatgaaccaggc
ctgcttggtcctaaggccctttttgctttcatggccctgtctttcattcgtgatgaggtc
acttggctggttcgccatacagaaaatgtcaccaagactaagacacccgaagactatgct
gactcgagcattgcagagcttctgttcctgttggaggagatcagggctctggtcagaaga
cacatcaaagttattcagcagtaccacctccagtacctggccagatttgatgtccttgtg
cttagtgacatcattcagaatctgtccgtgtgtccagaggaggagtctgtcattatgtcc
tcatttgttagtatactgtcctctctgaatctcaagcaagttgataatgaagagaaattt
gacttttctggattaaggctggattggtttcgcctacaggcatataccagcgtgtcgaag
gcacctttgcacctgcatgagaaccctgacctagccaaggtcatgaacctcatcatcttt
cactcccagatgttggactcagtagagaaaatgctggtggaaacctctgacctttctact
ttctgctttcatctccgtacctttgagaagatgtttgctacgaccctggaggaaccaacc
atgcttcgctacaccattgccttccccctgatttgtgctcattttgtccactgcgttcat
gaaatgtgcccagaggagtaccctcacctgaagaaccatggtcttcaccactgcaactcc
ttcctggaagatctggccaagcagaccagcaactgtgtgcttgagatatgtgcggaacag
cggaacctgaatgaacagcttctacctaagcactgtgccaccaccatcagcaaagccaag
aataagaagtccatgaagcagaggcaggctcccaggaaaggagagcctgagagggacaag
ccaggagcagagagtcatcggaagaaccgcagccttgtcactaacatggacaaactacat
ctaaacttgactgaattggcactggcaatgaatcatgtgcacagtttctctgtgtttgaa
cacaccatcttcccatctgagtatctcagcagtcacctggaggccaggcttaacagagcc
atcgtgactttggctggctacaatgccacaacccaggagatccttaggccttctgagctg
ctggcaggagtcaaagcatacatcagtttcatccagtcattggcacagtttttgggtgca
gatgcttccagaatcgttcgcaatgccctcctgcagcagacacagccactggactcatct
ggcgagcagactgtcaccactctctacacaaactggtacctagaaagtctccttagacag
gcgagcagtggagccattgtcctctccccagccatgcaggccttcatcagccttccccga
gatggagagcagaacttcagtgctgaggagttctcggacatctctgagatgcgagccttg
gctgaaattcttggtccctatggcatgaagttcctgagtgaaaacctgatgtggcatgtg
acctctcagattgtggagctgaagaagcttgtggtggaaaacatggatattctggtccag
atcagatccaacttcagcaagccagaattaatggcatctctgctgccccagctgacagga
gctgaaaatgtgctgaaacgaatgaccatcattggggtgattctcagttttagggccatg
gcccaagagggacttcaggaggttttttctgcccactgcccttttctcatgggccccatt
gagtgcctgaaggagtttgtcacccctgacacagacattaaggtcaccctgagtgtcttt
gagctggcatgtgctgcaggggtgagctgtgacattgacccagccttggtagctgccatt
gccaatctgaaagctgataactcatcccctgaagaagagtataaggtggcatgcctactc
ttgatctttcttgctgtttccctcccactccttgccactgacccgtcttccttcttcagc
attgagaaagatggctacaacaacaacatccactgtttgaccaaagccatcattcaggtg
tctgctgccctcttcactctgtacaacaagaacattgaaacgcacctcaaagagtttctg
gtggtggcctctgtcagcctcttgcagctgggccaggagactgacaagctcaaaaccaga
aatcgtgaatccatttctctgctcatgcgcttggtggtggaggagtcacccttcttgacc
ctggacatgctggagtcctgtttcccttacgttctgctacgcaatgcctatcgggaggtt
tcccgggccttctacttgaaccgtctgccagccagttcccactga

DBGET integrated database retrieval system