KEGG   Mus musculus (house mouse): 105866
Entry
105866            CDS       T01002                                 
Symbol
Krt72, AI507495, CK-72, K6irs2, K72, Krt2-35, Krt72-ps
Name
(RefSeq) keratin 72
  KO
K07605  type II keratin, basic
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    105866 (Krt72)
   04147 Exosome [BR:mmu04147]
    105866 (Krt72)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     105866 (Krt72)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   105866 (Krt72)
  Exosomal proteins of other body fluids (saliva and urine)
   105866 (Krt72)
  Exosomal proteins of colorectal cancer cells
   105866 (Krt72)
  Exosomal proteins of bladder cancer cells
   105866 (Krt72)
SSDB
Motif
Pfam: Filament Keratin_2_head CENP-F_leu_zip Baculo_PEP_C DUF1664 TPR_MLP1_2 ADIP PGDH_inter DUF6042
Other DBs
NCBI-GeneID: 105866
NCBI-ProteinID: NP_998893
MGI: 2146034
Ensembl: ENSMUSG00000056605
UniProt: Q6IME9
Position
15:complement(101684607..101694955)
AA seq 520 aa
MSRQLTLYPGAERLGFSGCSAVISGRLSGSHASVRAGVKGAAFGSRSLFCVGGGRRLALS
SAGRSGGFTLGHGGASGGRPGGFVGTVFGSAGLGPTCPSVCPPGGIPQVVVNKSLLAPLN
VELDPEIQKVRAQEREQIKALNNKFASFIDKVRFLEQQNQVLETKWELLQQLDLNNSKRS
LEPVHESYISNLQKQLEILSGDRVRLDSELRNMREVVEDCKKRYEVEINRRTAAENEFVV
LKKDVDAAYMNKVELQAKVDSLTDDIKFFKVLFEGEIAQMQSHISDTSVILSMDNNRQLD
LDSILAEVRAQYEEIAVKSKAETENMYQCKIQELQATAGQHGDDLKHTKSEITEINRLIQ
RIHSEIGNMKKQCSNLETAIADAEQRGDCALKDARAKLDQLEGALQQAKEELARMLREHQ
ELMNVKLALDMEIATYRKLLESEESRMAGEYPNSVSISVISSTNAGPGGAGFSVGFGASS
SYNYRPLALEVKTKGSCGSELKDPPAKTSGSSGTTKKTSR
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgagccgccagttgaccctctatcccggagctgagcgcctgggtttcagtggctgctct
gcggtcatctcaggcaggctcagtggcagtcacgcctcggtccgagctggagtcaaggga
gcagcatttgggagcagaagcctgttctgtgtggggggaggccggcggctggcgttgagc
tctgcagggcgaagtggtggcttcacgctgggccacggaggggcgagcggtgggcggcct
gggggcttcgtgggcaccgtcttcggcagcgcgggactggggcccacatgcccatcagtg
tgccctcccggtggcatcccccaggttgtcgtcaacaagagccttctggccccactcaat
gtggagctggacccggagatccagaaggtgcgggcacaagagagggagcagatcaaggct
ctgaacaacaagtttgcctccttcattgacaaggtccgcttcttggagcaacagaaccag
gtactggagaccaagtgggagctgctgcagcagctggacctaaacaactccaagaggagc
ctggagcctgtgcatgagagttacatcagcaacctgcagaagcagctggagatcctgtct
ggggatagggtgaggctggactcagagctgaggaacatgagggaagtggtggaggactgc
aagaagaggtacgaggtggagattaacagacgcacggctgccgagaacgagttcgtggtg
ctgaagaaggatgtggacgcagcttacatgaacaaggtggagctccaggccaaggtggac
tccttgacagatgacatcaaattcttcaaggttctctttgaaggggagatagctcagatg
cagtcccacatcagcgacacatccgtcattctctccatggacaataaccggcagctggac
ctggacagcatcctcgctgaggttcgagcccagtatgaggagattgctgtgaagagcaag
gcagagacggagaacatgtaccagtgtaagatccaggagctgcaggccactgcaggccaa
cacggggatgacctcaaacacaccaagtctgagatcacagagatcaacaggctgatccag
aggatccattcagagataggaaacatgaagaagcagtgctccaacctggagacggccatt
gctgacgctgaacagagaggtgactgtgctctcaaggatgcccgggccaagctggaccag
ctggagggagccctgcagcaggccaaggaggagctggcccggatgctgcgtgagcatcag
gagctcatgaatgtcaagctcgccctggacatggagatcgccacctacaggaagcttctg
gagagcgaggagagccggatggctggtgaatacccaaattctgtgagcatttctgtcatt
agcagtaccaatgcaggaccaggaggtgctggcttcagtgtgggctttggtgcctcgagc
agttacaactatagacctctggccctggaggtgaagaccaagggtagctgtggcagcgag
ctcaaggatcctccggccaaaacctcaggcagcagcggtacaaccaaaaagacctccaga
tga

DBGET integrated database retrieval system