KEGG   Mus musculus (mouse): 106025
Entry
106025            CDS       T01002                                 

Gene name
Sharpin, 0610041B22Rik, AW121341, RBCKL1, S, SIPL1, cpd, cpdm
Definition
(RefSeq) SHANK-associated RH domain interacting protein
  KO
K20894  shank-associated RH domain-interacting protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106025 (Sharpin)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106025 (Sharpin)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    106025 (Sharpin)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   LUBAC complex
    106025 (Sharpin)
SSDB
Motif
Pfam: Sharpin_PH zf-RanBP ubiquitin
Other DBs
NCBI-GeneID: 106025
NCBI-ProteinID: NP_079616
MGI: 1913331
Ensembl: ENSMUSG00000022552
Vega: OTTMUSG00000023724
UniProt: Q91WA6
Structure
PDB: 
5Y3T

Position
15 D3; 15 35.75 cM
AA seq 380 aa
MSPPAGGAAVAADPASPVVLLAVHAAVRPLGAGQDAEAQPRKLQLIADPERPGRFRLGLL
GTEPGAVSLEWPLEAICYTVRGPNQHELQPPPGGPGTFSVHFLDPEEAQQWAALVRDATA
EGQNGSGSPAPAPAPAMCPISPPCSSMAQIPKATQPEVDLPQSSGNFKKEELATRLSQAI
AGGDEKAAAQVAAVLAQHHVALNVQLMEAWFPPGPIRLQVTVEDATSVLSSSSSAHVSLK
IHPHCSIAALQDQVFSEFGFPPAVQRWVIGRCLCMPERSLASYGVSQDGDPAFLYLLSAP
REVSGQSLQNSKMDRKLGLFPQSLGLPHDLQPSSSSLPSPSQPGWSCPSCTFINASNRPG
CEMCSTQRPCAWDPLAAAST
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgtcgccgcccgccggcggtgcggcagtggctgcagaccctgcctcacctgtggtgctc
ctggcagtgcacgcggcggtcaggcccctgggcgctggacaggatgccgaagcgcagccg
cggaagctgcaattgatagcggaccctgagcggcctggacgcttccggctaggactgtta
ggcaccgagcctggggcggtcagtttagaatggcccttggaggctatttgttacaccgtc
cgtgggcctaaccaacacgagctgcagcctccccctggaggtcctggaaccttcagcgtg
cacttcctcgaccccgaggaagcacagcagtgggcagcactggtgcgagatgccaccgca
gaaggacaaaatggcagtggcagcccagccccagccccagccccagcaatgtgccccatt
tctccaccatgttcttctatggctcaaatacctaaagcaacccaacctgaggtggatctt
cctcaaagttctggaaacttcaaaaaagaagagctggctacacgcctgtcccaggccatt
gcaggtggggatgagaaagcagcggcccaagtggcagcagtcctggcgcagcatcatgtg
gctctcaatgtccagctcatggaggcctggttcccaccaggtcccataaggctacaagtc
acagttgaagacgccacatcggttttgtcctcttcatcgtctgcccatgtctcactgaag
atccacccacattgctccattgcagcccttcaggatcaggtgttctcagagttcggtttc
ccaccagctgtgcagcgctgggtcattgggcggtgcctgtgtatgcctgaacgaagcctt
gcttcctatggggtctctcaagatggagaccctgcttttctttacttgctctcggccccc
agagaagtttcaggacaaagccttcaaaactccaagatggaccggaaattaggcttgttt
cctcagtcactggggctgcctcatgacctccagccgtccagttccagtctcccaagtccc
tctcagcctggctggtcttgcccttcctgcactttcatcaatgcctcaaaccgccctggc
tgtgagatgtgtagcacccaaaggccctgtgcttgggatcctcttgctgcagcttccacc
tag

DBGET integrated database retrieval system