KEGG   Mus musculus (house mouse): 106042
Entry
106042            CDS       T01002                                 
Symbol
Prickle1, 1110058P22Rik, AW215793, Prickle, b2b019Clo, mpk1
Name
(RefSeq) prickle planar cell polarity protein 1
  KO
K04511  prickle
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106042 (Prickle1)
SSDB
Motif
Pfam: PET LIM Vasculin GatZ_KbaZ-like
Other DBs
NCBI-GeneID: 106042
NCBI-ProteinID: NP_001028389
MGI: 1916034
Ensembl: ENSMUSG00000036158
UniProt: Q3U5C7
Position
15:complement(93396992..93494147)
AA seq 832 aa
MPLEMEPKMSKLVFGCQRSSTSDDDSGCALEEYAWVPPGLRPEQIQLYFACLPEEKVPYV
NSPGEKHRIKQLLYQLPPHDNEVRYCQSLSEEEKKELQVFSAQRKKEALGRGTIKLLSRA
VMHAVCEQCGLQMNGGEVAVFASRAGPGVCWHPSCFVCFTCNELLVDLIYFYQDGKIHCG
RHHAELLKPRCSACDEIIFADECTEAEGRHWHMKHFCCLECETVLGGQRYIMKDGRPFCC
GCFESLYAEYCETCGEHIGVDHAQMTYDGQHWHATEACFSCAQCKASLLGCPFLPKQGQI
YCSKTCSLGEDIHASDSSDSAFQSARSRDSRRSVRMGRSSRSADQCRQSLLLSPALNYKF
PGLSGNADDTLSRKLDDVSLASRQGAGFANEEFWKARVEQEASEDPEEWAEHEDYMTQLL
LKFGDKNLFQQQSSEVDPRASEHWIPDNMVTNKPEVKPNHQGLASKKYQSDMYWAQSQDG
LGDSAYGSHPGPASSRRLQELDLDHGAAGYTHDQSQWYEDSLECLSDLKPEQSIRDSMDS
LALSNITGASVDGESKPRPSLYSLQNFEEIEAEDCEKMSNMGTLNSSMLHRSAESLQSLN
SGLCPEKILPEEKPAHLPVLRRSKSQSRPQQVKFSDDVIDNGSYDIEIRQPPMSERTRRR
AYHFEERGSRPHHHRHRRSRKSRSDNALNLVTERKYSAKDRLRLYTPDNYEKFIQNKSAR
ELQAYMQNANLYSQYAHATSDYALQNPGMNRFLGLCGEDDDSWCSSSTSSSDSEEEGYFL
GQPIPQPRPQRFTYYTDDLSSPASALPTPQFTQRTTKSKKKKGHKGKNCIIS
NT seq 2499 nt   +upstreamnt  +downstreamnt
atgcctttggagatggaaccgaaaatgagcaaactggtcttcgggtgccagagaagctcc
acatcagatgatgattccggctgtgcacttgaagagtatgcatgggtcccaccgggcctc
aggcccgagcagatccagctctatttcgcatgcttgccagaggaaaaggttccttatgtt
aacagccctggggagaaacacaggattaaacagctcctgtaccagttgcctccacacgat
aacgaggtgcggtactgccagtctttgagcgaagaagagaagaaggagctgcaggtgttc
agtgctcagaggaagaaagaagctctggggagaggaaccatcaaactcttgtccagagct
gtgatgcacgccgtgtgtgagcagtgtgggctgcagatgaatggaggggaggtggccgtg
ttcgcctcccgtgcaggacctggagtatgctggcacccgtcctgctttgtctgcttcacg
tgtaatgaactactggtcgacctcatctatttctatcaggatggaaaaatccactgtggc
aggcaccacgctgaactgctcaagcctcggtgctcagcctgtgatgagatcatttttgct
gacgagtgcacggaagccgagggtcgccactggcacatgaagcatttctgctgtctggaa
tgtgagacagtcctgggagggcagagatatatcatgaaggacggccgccccttctgctgt
ggctgcttcgagtctctctacgctgagtactgcgaaacctgtggggagcatattggtgtg
gaccacgcacagatgacctacgacgggcagcactggcacgccacagaggcctgcttttcc
tgtgcgcagtgtaaggcctcgttgctgggatgccccttcctcccgaaacaaggtcagatt
tactgctccaagacctgcagccttggggaagacatccacgcctctgactcctcggactcc
gccttccagtcagccagatccagagactctcgcaggagcgtgaggatgggcagaagcagc
cgctccgccgaccagtgccgacagtctcttctcttgtctcccgccctgaactacaagttc
ccgggtctctccggcaacgctgacgacaccctttcccggaagctggatgacgtgagcctc
gccagcaggcagggagcaggtttcgctaacgaggaattctggaaagccagagtggagcag
gaagcctccgaagaccccgaagaatgggctgagcatgaagattatatgacgcagctcctc
ctcaagttcggcgacaaaaacctcttccagcagcagagcagcgaggtggatccgagagcc
agcgagcactggatacccgacaacatggttacgaataagcccgaggtaaagccgaatcac
cagggcctcgcgagtaaaaagtatcagtctgatatgtactgggcccagtcccaagacggg
ctgggtgactctgcctacggcagccatccaggccccgccagcagccgcaggctgcaagag
ctagatctggaccacggtgctgcgggatatactcatgaccaaagccagtggtatgaagac
tccctggagtgtctatctgacttgaaaccagaacagagtatccgggattctatggattct
ttggcgttgtccaacatcacaggggcatcagtggatggagaaagcaagccaagaccgtca
ttatattctctccaaaactttgaggagatagaggcagaagattgtgagaaaatgagcaat
atgggaactctgaactcttccatgctgcacaggagtgcagaatccttacaaagtctgaac
tcagggctgtgcccagaaaaaattctacctgaggaaaaaccagcacacctgccggtgctc
aggagatccaagtcccagtcccgaccacagcaggtcaaattttcagatgacgtcattgac
aacggaagctacgacatcgaaatccggcagcctcccatgagcgaacggactcggagacgg
gcgtatcactttgaagagaggggatccaggcctcaccaccatcgccaccggagaagcaga
aagtctcggtccgacaacgccctgaacctggtcacggaaaggaagtactccgccaaggac
agacttcggctgtacacccccgataactatgagaaattcatacagaataaaagcgcccgg
gagctccaagcctacatgcagaacgccaacctctatagccagtatgcccatgccacgtct
gattacgccctgcagaacccagggatgaaccggtttctggggctctgcggcgaggacgac
gactcgtggtgttcgtcctccacgtcctcctccgactcagaagaagaaggctatttcctt
ggccagccgatccctcagccacggccacagagattcacctactatacagatgacctttct
agcccggcttccgcactgcccaccccacagtttactcagaggacaactaaatccaagaag
aaaaaaggacacaagggcaaaaactgtatcatttcttaa

DBGET integrated database retrieval system