KEGG   Mus musculus (house mouse): 106064
Entry
106064            CDS       T01002                                 
Symbol
Rimoc1, AI195826, AW549877
Name
(RefSeq) RAB7A interacting MON1-CCZ1 complex subunit 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DUF5561 FANCF DUF6732
Other DBs
NCBI-GeneID: 106064
NCBI-ProteinID: NP_666042
MGI: 2146232
Ensembl: ENSMUSG00000041935
UniProt: Q8BR90
Position
15:complement(4011517..4025228)
AA seq 294 aa
MAAAVSGVVRRVEELGDLAQAHIQHLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNP
SNLLELYTQAILDMTYFEENKLVDEDFPEDCSPQKVKELLAFLSEPEILAKESNMHPKLC
GLLGAELLECLSWRRGALLYMYCHSLTKRREWLLRKSNLLQKYLVDGINYLLQMLNYRCP
VQLNEGVSFQDLDTAKLLSTGVFSDIHVLAMMYSGEMCYWGLKHCTDQQSENHEVDTDVF
GASCTTHKETLDFREVGEKILKKYVSVCEGPLKEQEWNTANAKQILSFFQQRCS
NT seq 885 nt   +upstreamnt  +downstreamnt
atggcggccgcggtgtccggtgtggtgaggcgggtggaagagctcggggacctggctcag
gctcacatacagcaccttagcgaagccgcgggggaagacgatcactttttaattcgagcc
tctgcagctctagaaaaattgaaacttttatgtggagaagagaaagaatgttcaaatcca
tccaatcttttggaactatatacacaggccatcctggacatgacatattttgaggagaac
aagctagtagatgaggattttccagaggactgttctccacagaaagtaaaagagctgctc
gcgtttctttcagaaccagaaatcttagctaaagaaagcaatatgcatcccaagctgtgc
ggtttgcttggggctgagctcctggagtgcctctcttggaggcgaggggccctgctgtac
atgtattgtcattcgctgactaagagaagggagtggctcctcagaaaatccaacttgctt
caaaagtaccttgttgatgggatcaattacttgctacagatgctaaattatcgatgccct
gtccagttaaatgaaggtgtttctttccaagacctagacacagctaaattgctgagtaca
ggagtctttagtgacatccatgtgctggctatgatgtacagtggagagatgtgctactgg
gggttaaagcactgcacagatcagcagtcagaaaaccatgaagttgatactgatgttttt
ggagcaagctgcaccacacacaaagaaaccttggatttccgagaagtaggagaaaaaatt
ttgaagaagtatgtgtcggtgtgtgaaggacctctgaaggagcaagagtggaacaccgca
aacgcaaagcaaatcttaagtttctttcagcagcgctgtagctag

DBGET integrated database retrieval system