KEGG   Mus musculus (house mouse): 106200
Entry
106200            CDS       T01002                                 
Symbol
Txndc11, 2810408E11Rik, AI427833, EFP1, Txdc11
Name
(RefSeq) thioredoxin domain containing 11
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_6 ATG16 Thioredoxin_8 Glrx-like RII_binding_1 COG6
Other DBs
NCBI-GeneID: 106200
NCBI-ProteinID: NP_083858
MGI: 1923620
Ensembl: ENSMUSG00000022498
UniProt: Q8K2W3
Position
16:complement(10892775..10952541)
AA seq 948 aa
MSECGGRGGGGGNNSEDAEDEGGGPKGSGSLSPAGAAASLEGRIRRGLRGASLMARQRPE
LLCGAVALGCALLFALKFTCSRAKDVIIPAKPPVSFFSSRSPVLDLFQGQLDYADHVRQD
SEVVVLFFYAPWCGQSIAARAEIEQAASRLSDQVLFVAINCWWNQGKCRKQKHFFYFPVI
HLYHRSFGPIEYKGPMSAVYIEKFVRRAMKPLLYIPSQSALLDFLSSYEPGVLGYFEFSG
SPQPPGYLTFFTSALHSLKKDYLGTVRFGVITDKHLARLVSLVHSGSVYLHRHFNTSLVF
PREVMNFTAENIYKWASENQETLFRWLQPHGGKSLLLNNELKKGPALFLFIPFDPLAERH
PLLDEITEVALEYNNCHGDQVVERLLQHLRRVEAPVLQSLAPELPASLPDTQLMAASPCC
NTVVLPQGPALSRTHNVCELCVNQTVGGTRPSSVSVPQCSFFEMAAALDSFYLKEQTFYH
VVSGSIECSNFLTSYSPFSYYTACCRTISRGMASFTGSEQNVLTAPAIEFSSLEKSCEAT
APSSIPHIEENRYRFPQVGLTSTAFTGLSCRTNKTLNIYLLDSNLFWLYAERLGAPSSAP
VKEFATIVDVKEESHYILDPKQALMKFTLESFIQNFSVLYSPLKRHLTGSDSAQFPTQHL
ITEVTTDTFWEVTLRKQDVLLLYYTQWCGFCPSLNHIFIQLARLLPEDTFTVARIDVSQN
DLPWEFMVDRLPTVLFFPCNRKDLSVKYPGDLPITLPNLLRFILHHSDAASAPQDPGISP
PTQDCVQSKAVLQREHISHVENAMQKLRSEMSSLRRTQEQVEGRLLSARRDGHRLLRRQR
TLEQQHRLLRRHSQKLQALYLKKARELQELARASGTPLPEHTWLKILVATMERELEGQGG
AKEPAPLGKARPNHSKSMGTTQLPGDTPPPSTTSSTLASETKHENRTD
NT seq 2847 nt   +upstreamnt  +downstreamnt
atgtcggaatgcggaggccgcggcggcggcggcgggaacaacagcgaggacgccgaggac
gagggtggcggccccaagggctcaggctccctcagccctgccggggcggcggcgtccttg
gagggccggatccgccgcggcttgcgcggcgcctcgcttatggcgcgccagcggccagag
ctgctgtgcggggccgtggctctcggctgcgccctgctcttcgccctcaagttcacttgc
agtcgagcaaaagacgtgataataccagcaaagccgcctgtcagctttttctcctcgaga
tctccggtccttgacctcttccaggggcagctggactatgctgaccatgtccgccaggat
tctgaggtggtggtgctgttcttctatgccccgtggtgtggccagtccatcgctgccagg
gcagaaattgagcaggcagccagccggctttctgatcaggtgttgtttgtggcaataaac
tgttggtggaaccaggggaaatgcagaaaacagaagcatttcttctattttcctgtgata
catctgtatcatcggagttttggaccaatcgaatacaaaggccccatgagtgctgtttac
attgagaagtttgtccgccgggcgatgaagccgcttctctacatcccgtctcaatcagca
ttgctagactttctctccagctatgagcctggagtactcggatactttgaattcagcggt
tcaccccagcctcctggttacttgaccttcttcacctcagcactgcattcgttaaagaaa
gattacctaggaacagtgcgatttggggttatcacagataaacaccttgcgagactggta
tccttagtgcactctggaagtgtgtatttacatagacatttcaacacatcacttgtcttc
cccagggaagtcatgaacttcacagctgagaacatctataagtgggcctcagaaaaccag
gagaccctcttccgatggctacagcctcatggaggcaagagtctgctgttgaacaatgag
ctgaagaaaggaccagcactcttcctgttcataccgtttgatcccctagccgagagacat
cctcttctagatgagatcaccgaagtggccttggaatacaataactgtcatggggaccag
gtggtagagcgcctccttcagcacctgcggcgggtagaggcacctgtgctccagtccctg
gcaccagagctgccagcttcactgcctgatactcagctgatggcagcatccccctgctgt
aacacggtggtgctgccacaggggccagccctctccaggactcacaatgtctgtgagctg
tgtgtcaaccagacagtgggtggtaccaggcctagctcagtgagtgtgccacagtgcagc
ttcttcgagatggcagccgctctggattctttctacctcaaggagcagactttttatcat
gtggtgtcgggcagcatagaatgcagcaattttttaacctcctatagccctttcagctac
tacactgcatgttgcaggaccatatcccggggcatggcaagctttactggctctgaacag
aatgtcttgacagccccagccatcgagttctcttccttagagaagagctgtgaggccact
gccccgagctccattcctcacattgaggagaacaggtaccgctttcctcaagtgggcctc
actagcacagccttcacgggcctgagctgcagaaccaacaagaccctgaacatctacctt
ttggattccaatttattttggttatatgcagaaagactgggtgccccgagctctgctcct
gtgaaggagtttgccacaattgttgatgtgaaagaagaatctcactatatcctggatccc
aaacaagccctcatgaagttcactctagagtcttttattcaaaacttcagtgttctctac
agccccttgaaaaggcatctcactggaagtgattctgctcagtttcccactcagcatttg
atcacggaagtgacgactgataccttctgggaagtaacccttcggaaacaggacgttctg
ctgctctattatacacagtggtgtggcttttgcccgtctctcaatcacatcttcatccag
ctagctcggctcctgccagaggacacatttactgtggccaggatcgacgtgtctcagaat
gatcttccttgggaattcatggttgaccgtcttcctaccgttttgttttttccctgcaat
agaaaggacctaagtgtgaaataccctggagacctccctatcaccctcccgaatctgctg
cggttcattctgcatcactcagacgctgcctctgccccccaggaccctggcatcagccct
cctacccaagactgtgtccagagcaaggcagtgctgcagcgcgaacacatctctcacgtg
gagaatgcgatgcagaagctgagatctgagatgagcagcctacgccgtacacaggagcag
gtggagggcaggctccttagtgcccgcagggatgggcaccgcctgctgcgccggcagcgg
accctggagcagcagcacaggctactccggcgccacagccagaaactgcaggctctgtat
ttaaagaaggcgcgagagctccaagagctggctagagcctcaggaacccccctccccgag
cacacatggctcaagatccttgtggccactatggagagggagctggaaggccaaggtggg
gctaaggaaccagcccctctgggaaaggctcgaccgaaccactccaagtccatgggtaca
actcagttacctggtgacacccctccgccctccaccaccagctccactttggcttcagag
acgaagcatgagaataggacagactaa

DBGET integrated database retrieval system