KEGG   Mus musculus (house mouse): 106205
Entry
106205            CDS       T01002                                 
Symbol
Zc3h7a, A430104C18Rik, AI447294, AW556219, HSPC055, Zc3h7, Zc3hdc7
Name
(RefSeq) zinc finger CCCH type containing 7 A
  KO
K24945  zinc finger CCCH domain-containing protein 7
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    106205 (Zc3h7a)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Zinc finger domain-containing proteins
  Other zinc finger domain-containing proteins
   106205 (Zc3h7a)
SSDB
Motif
Pfam: zf-C2H2_jaz zf_CCCH_4 zf-CCCH_4 zf-CCCH zf-met TPR_2
Other DBs
NCBI-GeneID: 106205
NCBI-ProteinID: NP_666043
MGI: 2445044
Ensembl: ENSMUSG00000037965
UniProt: Q3UBH9 E9PWW6
Position
16:complement(10954458..10994257)
AA seq 970 aa
MSSVSEERRKRQHSIKEGLQFIQSPLSYPGTQEQYAVYLHALVRNLFNEGNDIYRECDWR
GSLIQYSEALSIANYAKSEEILIPTEIIEKLRINRIACYSNMGLRDEVLEDCNAVLSVNA
SNCKALYRKAKALSDLGHYREAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYVR
AEHLLKAVPGDGAPKAVNYSVEDIEPDLLAPRQEALSVASLPTSSFSHVIGSELASVPIM
PVTSVLQLQVDESPLPSTVFANGGKIPFTISDAFLDDDIVLGDEIDALLDSAPETNDAVM
SSTLVRGPLPTASAAPSLPFRTQSLLGTLPMGTRYPEPSFADFFPPLTSSLEEFYSSLNS
FSVTESKRDLCTSTAREGTPLNNSNSSLLLMNGPGNLLASENFLGITSQPRNDFGNFFGS
VIAKPFSSGTPRHPLEGTHELRQACQICFVKSGPKLMDFTYHANVDHKCKKDILIGRIKN
VEDKSWKKIRPRPTKTNYEGPYYICKDVAADDECRYPGHCTFAYCQEEIDVWTLERKGAF
SREAFFGGNGKINLTVVRILQEHHGEFTFLCEKCFDHKPRMISKRNKDNSTACSHPVTKH
EFEDNKCLVHILRETTVKYSKIRSFHKQCQFDICRHEVRYGCVREDECFYAHSLIELKVW
IMQSERGISHDDIAQQSKQYWRSLQASMPGVQVLGNQIMPGLLNMEIKFVCAQCLRNGQV
IEPDRNRKYCSAKAQHSWTKERRAMRAMSFERKKWMNIRPLPTKKQMPLQFDLCNHIANR
KKCQYVGNCSFAHSPEEREVWTYMKDNKIHDIEQFYELWLKNQKTEKSDETASHCSKENG
KQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQDHISSEKHKEKVFHTEDDQYCWQHRFPT
GYFSICERYINGSCTEGSSCKFAHGNAELHEWEERRKALQMKFKKARKDHLIAPNDNDFG
KYSFLFKDLK
NT seq 2913 nt   +upstreamnt  +downstreamnt
atgtccagtgtgtccgaggagagaagaaagaggcagcacagcataaaggaaggtctacag
ttcatccagtctccgctgtcatatcctgggacccaggagcagtatgcggtgtatttgcat
gctctcgtgagaaatctttttaatgaaggaaatgatatttatcgggaatgtgactggcgt
ggctctctaattcagtactcagaagctttgagtatagctaattatgcaaagtctgaagaa
attttaattcctacagaaatcattgaaaaacttcgtataaatcgtattgcttgctattct
aatatgggcctccgtgatgaagttttagaagactgtaacgctgtcctcagtgttaatgcc
agtaactgcaaggctctgtatcggaaggctaaggctctaagtgacttagggcactacaga
gaggcctacgacgctgtggcaaagtgctccttagcagtgcctcaggatgaacatgtaata
aaattaactcaagaattagctcagaaattgggatttaaaataaggaaagcatatgttaga
gctgagcacttactgaaagcagttcctggggatggggctcccaaggctgtgaactattct
gtggaagatattgagccagatttgttagccccaaggcaagaagcactttcggttgcctcc
cttcctacatccagtttttctcatgtcattgggagtgagctggcctctgttcctattatg
ccggtaacttctgttttgcaactgcaagtggatgagagtcctctgccatccacagtgttt
gcaaatggagggaagatccccttcaccatatccgatgcttttctggatgatgacattgtc
cttggggatgaaatagatgctcttcttgattctgccccagaaacaaatgatgctgttatg
tcctccactctggtcagaggacccctcccgactgccagtgcagctccgagcttgcccttc
aggacacaatccctgcttggaaccttgcccatgggtacaaggtatcctgagccctccttt
gcagacttttttccacctctgacttcatccttggaagaattttactcttctttaaattca
ttttcagtgactgaatccaaacgagatctgtgcacctcaactgctagagagggaacaccg
cttaacaacagtaattcctcccttttacttatgaatggaccaggtaatttgttggcctct
gaaaattttctgggaattacaagtcagcctagaaatgactttggaaacttttttggaagt
gtgatcgctaaaccattttcatcagggactcctaggcatcccctcgaaggaacccacgag
ctgaggcaagcttgccagatctgctttgtaaaatcaggccctaagttaatggatttcaca
taccatgctaatgtagatcataaatgtaagaaagatattttaattggtaggataaaaaat
gttgaagataaatcatggaaaaaaatacgtccaagaccaacaaaaacaaattatgaagga
ccatattatatatgcaaagatgttgctgcagatgatgaatgccgatatcctggccactgt
acatttgcttattgccaagaagagatagatgtgtggaccctggaaagaaaaggggcattc
agtcgagaggctttctttgggggcaatggaaagatcaaccttactgtggtcagaattctc
caagagcatcatggagagtttacattcctttgtgagaaatgttttgatcataaacctaga
atgataagtaaaagaaataaagataattccactgcctgctctcaccccgtcacaaagcat
gaatttgaggacaataagtgccttgtccacattttgagagagaccacagtaaaatattcc
aaaatacgttcttttcataaacaatgtcaatttgatatttgtcgacatgaagttcgttat
ggctgcgtgagggaagatgagtgcttctatgcccatagtcttattgaactgaaagtctgg
ataatgcaaagtgaaagaggtatctcccatgatgatattgctcaacaatccaaacaatat
tggagaagtttgcaagcaagcatgccgggagtgcaggtccttggtaatcaaataatgcct
ggattacttaacatggagataaagtttgtatgtgctcagtgtctgagaaatggccaagtc
attgaaccagacaggaacagaaagtactgcagtgccaaagcacagcattcgtggaccaaa
gaacgtcgtgcaatgagagcgatgtcttttgaacgtaagaagtggatgaacatccgtcct
ctccccacaaagaaacaaatgcctttacagtttgatctatgcaaccatattgctaataga
aaaaagtgtcagtatgttggcaactgttcctttgctcatagtccagaggagcgggaagtg
tggacttacatgaaggataacaaaatacatgatatagagcaattttatgaactctggctg
aagaaccaaaaaactgaaaaaagtgatgagacagccagtcactgtagcaaagaaaacggg
aagcagatccatatgccaacagactatgctgaagtcactgtggacttccactgctggatg
tgtgggaagaactgtaacagtgagaagcaatggcaagaccacatctcctctgagaagcac
aaggagaaggttttccacactgaggatgaccagtactgctggcagcaccgcttccccact
gggtacttcagtatttgtgagaggtatataaatggctcctgcacagaaggaagcagctgt
aaatttgcacatggaaatgctgaacttcatgaatgggaagaaagaagaaaggccctacag
atgaaattcaagaaagcacggaaagatcacttaattgccccaaatgataatgactttgga
aaatatagttttttgtttaaagatttaaagtaa

DBGET integrated database retrieval system