KEGG   Mus musculus (mouse): 106248
Entry
106248            CDS       T01002                                 

Symbol
Qtrt2, 3110012M05Rik, 4930470H18Rik, AI648807, Qrt, Qrtr2, Qtrtd, Qtrtd1
Name
(RefSeq) queuine tRNA-ribosyltransferase accessory subunit 2
  KO
K15407  queuine tRNA-ribosyltransferase accessory subunit
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    106248 (Qtrt2)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    106248 (Qtrt2)
SSDB
Motif
Pfam: TGT
Other DBs
NCBI-GeneID: 106248
NCBI-ProteinID: NP_083404
MGI: 1922194
Ensembl: ENSMUSG00000022704
Vega: OTTMUSG00000026821
UniProt: B8ZXI1 Z4YJE9
Structure
PDB: 
6FV5

Position
16; 16 B4
AA seq 345 aa
MMKLSLIKVVNGCRLGKIQNLGKAGDCTVDIPGCLLYTRTGSAPHLTHQTLRNIHGVPGI
AQLTLSSLAEHHEVLAEYKKGVGSFIGMPESLFYCSLHDPVTPGPAGYVTSKVLQKSVII
GVIEGGDVMEERLRSARETAKRPVGGFLLDGFQGDPAVTETRLHLLSSVTAELPEDKPRL
ICGVSRPDEVLECIERGVDLFESFFPYQVTERGCALTFTFDCQLNPEETLLQQNGIQEKI
KGLDQAKKIEATGCNQEMTSFEINLKEKKYQEDFDPLVRGCSCYCCKNHTRAYIHHLLMT
NELLAGVLLMMHNFEHYFGFFCSIREALKNDTLAQLKELICRQMF
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgatgaagctgagtctcatcaaagtcgttaatggctgtcgtctaggaaaaatacaaaac
ctgggcaaagcaggggactgcacggtggacattccgggctgtcttctctacaccaggact
ggctctgccccacacctgacacatcagacgctgcgtaacatccacggggtcccaggcata
gcccagctcacactctcatccctagcagaacatcatgaagtcttggcagaatataagaaa
ggagttggaagctttataggcatgccggaatcactcttctattgttccctgcacgatcca
gtcacccccggcccagctggttatgtaacaagtaaggtcctccagaaaagtgtgatcatt
ggagtgattgagggtggagatgtgatggaagagaggttgaggtcagcacgagagacagcc
aagcgacccgtcgggggcttcctgctggacggctttcaaggggatccagcagtcacagaa
accagactgcacttgctgtcatcagtcactgcagagctgccagaggacaaaccaaggctc
atctgcggtgtcagccggccagacgaagtgctagagtgcatcgaaaggggagtggacttg
tttgagagttttttcccatatcaagtgaccgagcggggctgtgccctgactttcaccttt
gattgccagctgaatcctgaggagacactattgcaacaaaatggaatccaagaaaaaata
aaaggcttggatcaagcaaagaaaattgaagcaactggttgcaaccaagagatgacgtca
tttgaaattaatctgaaggagaaaaagtaccaggaagactttgacccgcttgtaagaggg
tgctcctgttactgctgtaagaaccacactcgtgcgtatatccaccatcttctgatgacc
aacgagctgctggctggtgtcctccttatgatgcacaactttgagcactactttggattt
ttctgctccatccgagaagcactaaagaatgacacactggcacagctgaaagaactcatt
tgcagacagatgttttga

DBGET integrated database retrieval system