KEGG   Mus musculus (house mouse): 106344
Entry
106344            CDS       T01002                                 
Symbol
Rfc4, A1, RFC37
Name
(RefSeq) replication factor C (activator 1) 4
  KO
K10755  replication factor C subunit 2/4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03030  DNA replication
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    106344 (Rfc4)
   03420 Nucleotide excision repair
    106344 (Rfc4)
   03430 Mismatch repair
    106344 (Rfc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    106344 (Rfc4)
   03036 Chromosome and associated proteins [BR:mmu03036]
    106344 (Rfc4)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    106344 (Rfc4)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    106344 (Rfc4)
  DNA Replication Termination Factors
   ELG1-RFC complex
    106344 (Rfc4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    106344 (Rfc4)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     106344 (Rfc4)
  Check point factors
   HRAD17(Rad24)-RFC complex
    106344 (Rfc4)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 AAA_16 DUF815 AAA_assoc_2 AAA_30 AAA_11 AAA_19 AAA_24 AAA_22 DNA_pol3_delta Mg_chelatase AAA_23 RuvB_N DUF2075 AAA_5 HrcA_DNA-bdg bpMoxR ResIII AAA_28 AAA_7
Other DBs
NCBI-GeneID: 106344
NCBI-ProteinID: NP_663455
MGI: 2146571
Ensembl: ENSMUSG00000022881
UniProt: Q99J62
Position
16:complement(22932698..22946480)
AA seq 364 aa
MQAFLKGTSVSAKAQLTKDRGTPATAGSSGETKKVKPVPWVEKYRPKCVDEVAFQDEVVA
VLRKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVR
EKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLIC
NYVSRIIEPLTSRCSKFRFKPLSDKIQQERLLDIAEKENVKIGNEEIAYLVKISEGDLRK
AITFLQSATRLTGGKEVSEDVITDIAGVIPAATIDGIFTACHSGSFDKLEAVVKNLIDEG
HAATQLVNQLHDAIIENENLSDKHKSIITEKLAEVDKCLADGADEHLQLMSLCATVMQQL
TQNC
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgcaggcatttctgaaaggcacatctgtcagtgccaaagcacaactgaccaaggaccgg
gggacacctgccactgcaggaagcagtggagaaaccaagaaagtcaaaccagttccttgg
gtggaaaaataccgtccaaagtgtgtggatgaagtggctttccaggacgaagtggttgca
gtgctgagaaagtccttagaaggagctgaccttcctaatctcttgttctatgggccacct
ggaactggcaaaacatccaccattttggcagcagctagagagctctttgggcctgaactc
tttcgattaagagtccttgagttaaatgcatctgatgaacgtggaatacaagtagtccga
gagaaagtgaaaaattttgctcagttaactgtatcaggaagtcgttcagatgggaagcca
tgtcctccctttaagattgtaattctggatgaagcagattcgatgacttcagctgctcag
gcagctttaaggcgtaccatggaaaaagaatcaaaaacaaccagattctgcctcatctgt
aactatgtcagtcgaataattgaacccctcacttctagatgttcaaaattccgcttcaag
cctctgtcagataagattcaacaggagcgattactggatattgctgagaaggaaaatgtc
aaaattggcaatgaggaaatagcgtatcttgttaagatatcagaaggagatttacggaaa
gccatcacatttcttcagagtgccactcgactaacaggtggaaaggaagtctctgaagat
gtgatcacagacattgctggggtaataccagctgcaaccattgatggaatattcactgca
tgtcacagtggctcttttgacaaactagaagctgtggtaaagaacctcatagatgaagga
catgcagctactcagcttgtcaatcaacttcatgatgcaattatagaaaatgaaaatctg
tctgataaacacaagtccattatcacagagaaacttgctgaagtagacaagtgcttggca
gatggtgcagatgaacacctgcagttgatgagcctttgtgcaactgtgatgcagcagcta
actcagaactgttag

DBGET integrated database retrieval system