KEGG   Mus musculus (mouse): 106344
Entry
106344            CDS       T01002                                 

Gene name
Rfc4, A, A1, AI894123, AU040575, RFC3, RFC37
Definition
(RefSeq) replication factor C (activator 1) 4
  KO
K10755  replication factor C subunit 2/4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    106344 (Rfc4)
   03420 Nucleotide excision repair
    106344 (Rfc4)
   03430 Mismatch repair
    106344 (Rfc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    106344 (Rfc4)
   03036 Chromosome and associated proteins [BR:mmu03036]
    106344 (Rfc4)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    106344 (Rfc4)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    106344 (Rfc4)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     106344 (Rfc4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    106344 (Rfc4)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     106344 (Rfc4)
  Check point factors
   HRAD17(Rad24)-RFC complex
    106344 (Rfc4)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 AAA_16 DUF815 AAA_assoc_2 AAA_30 AAA_11 AAA_19 AAA_24 AAA_22 DNA_pol3_delta Mg_chelatase AAA_23 RuvB_N DUF2075 AAA_5 HrcA_DNA-bdg bpMoxR ResIII AAA_28 AAA_7
Other DBs
NCBI-GeneID: 106344
NCBI-ProteinID: NP_663455
MGI: 2146571
Ensembl: ENSMUSG00000022881
Vega: OTTMUSG00000025290
UniProt: Q99J62
Position
16; 16 B1
AA seq 364 aa
MQAFLKGTSVSAKAQLTKDRGTPATAGSSGETKKVKPVPWVEKYRPKCVDEVAFQDEVVA
VLRKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVR
EKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLIC
NYVSRIIEPLTSRCSKFRFKPLSDKIQQERLLDIAEKENVKIGNEEIAYLVKISEGDLRK
AITFLQSATRLTGGKEVSEDVITDIAGVIPAATIDGIFTACHSGSFDKLEAVVKNLIDEG
HAATQLVNQLHDAIIENENLSDKHKSIITEKLAEVDKCLADGADEHLQLMSLCATVMQQL
TQNC
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgcaggcatttctgaaaggcacatctgtcagtgccaaagcacaactgaccaaggaccgg
gggacacctgccactgcaggaagcagtggagaaaccaagaaagtcaaaccagttccttgg
gtggaaaaataccgtccaaagtgtgtggatgaagtggctttccaggacgaagtggttgca
gtgctgagaaagtccttagaaggagctgaccttcctaatctcttgttctatgggccacct
ggaactggcaaaacatccaccattttggcagcagctagagagctctttgggcctgaactc
tttcgattaagagtccttgagttaaatgcatctgatgaacgtggaatacaagtagtccga
gagaaagtgaaaaattttgctcagttaactgtatcaggaagtcgttcagatgggaagcca
tgtcctccctttaagattgtaattctggatgaagcagattcgatgacttcagctgctcag
gcagctttaaggcgtaccatggaaaaagaatcaaaaacaaccagattctgcctcatctgt
aactatgtcagtcgaataattgaacccctcacttctagatgttcaaaattccgcttcaag
cctctgtcagataagattcaacaggagcgattactggatattgctgagaaggaaaatgtc
aaaattggcaatgaggaaatagcgtatcttgttaagatatcagaaggagatttacggaaa
gccatcacatttcttcagagtgccactcgactaacaggtggaaaggaagtctctgaagat
gtgatcacagacattgctggggtaataccagctgcaaccattgatggaatattcactgca
tgtcacagtggctcttttgacaaactagaagctgtggtaaagaacctcatagatgaagga
catgcagctactcagcttgtcaatcaacttcatgatgcaattatagaaaatgaaaatctg
tctgataaacacaagtccattatcacagagaaacttgctgaagtagacaagtgcttggca
gatggtgcagatgaacacctgcagttgatgagcctttgtgcaactgtgatgcagcagcta
actcagaactgttag

KEGG   Mus musculus (mouse): 19687
Entry
19687             CDS       T01002                                 

Gene name
Rfc1, 140kD, 140kDa, Alp, Alp145, RFC14, RFC140, Recc, Recc1
Definition
(RefSeq) replication factor C (activator 1) 1
  KO
K10754  replication factor C subunit 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    19687 (Rfc1)
   03420 Nucleotide excision repair
    19687 (Rfc1)
   03430 Mismatch repair
    19687 (Rfc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    19687 (Rfc1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    19687 (Rfc1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    19687 (Rfc1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     19687 (Rfc1)
SSDB
Motif
Pfam: RFC1 BRCT AAA PTCB-BRCT RuvB_N Rad17 AAA_22 AAA_16 AAA_33 BRCT_2 AAA_14 AAA_5 AAA_18 AAA_7 RNA_helicase AAA_17 NTPase_1
Other DBs
NCBI-GeneID: 19687
NCBI-ProteinID: NP_035388
MGI: 97891
Ensembl: ENSMUSG00000029191
Vega: OTTMUSG00000038036
UniProt: P35601 G3X8Z6
Position
5 C3.1; 5 33.61 cM
AA seq 1131 aa
MDIRKFFGVISSGKKPVNETVKNEKTKASEGTVKGKKGVKEAKVNNSGKEDASKPKQHSK
KKRIINDSDSESEETVQVKNAKKKSEKLSLSYKPGKVSQKDPVTYVSETDEDDDFVCKKA
ASKSKENGVSTNSYLGTSNVKKNEENVKTKNKPLSPIKLTPTSVLDYFGTESVQRSGKKM
VTSKRKESSQNTEDSRLNDEAIAKQLQLDEDAELERQLHEDEEFARTLALLDEEPKIKKA
RKDSEEGEESFSSVQDDLSKAEKQKSPNKAELFSTARKTYSPAKHGKGRASEDAKQPCKS
AHRKEACSSPKASAKLALMKAKEESSYNETELLAARRKESATEPKGEKTTPKKTKVSPTK
RESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLTFVITGVLESIER
DEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKILDEDGLLDLIRTMP
GKRSKYEMAAEAEMKKEKSKLERTPQKNDQGKRKISPAKKESESKKCKLTLLKNSPMKAV
KKEASTCPRGLDVKETHGNRSSNKEECLLWVDKYKPASLKNIIGQQGDQSCANKLLRWLR
NWHKSSPEEKKHAAKFGKLASKDDGSSFKAALLSGPPGVGKTTTASLVCQELGYSYVELN
ASDTRSKNSLKAVVAESLNNTSIKGFYTSGAAPSVSARHALIMDEVDGMAGNEDRGGIQE
LIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKSAMLSIAFKEGLKIP
PPAMNEIILGANQDVRQVLHNLSMWCAQSKALTYDQAKADSQRAKKDIRLGPFDVTRKVF
AAGEETAHMSLMDKSDLFFHDYSIAPLFVQENYLHVKPVAAGGDMKKHLMLLSRAADSIC
DGDLVDNQIRSKQNWSLLPTQAIYASVLPGELMRGYMTQFPSFPSWLGKHSSTGKHDRIV
QDLSLHMSLRTYSSKRTVNMDYLSHIRDALVRPLTSQGVEGAQHVIKLMDTYYLMKEDFE
NIMEVSSWGGKPSAFSKLDPKVKAAFTRAYNKEAHLTPYSLQVVKTSRLSTGPALDSEYS
EEFQEDDTQSEKEQDAVETDAMIKKKTRSSKPSKSEREKESKKGKGKNWKK
NT seq 3396 nt   +upstreamnt  +downstreamnt
atggacattcggaaattctttggggttatatcaagtggaaaaaagcctgtaaacgagaca
gtaaagaatgagaagacaaaagcttcggagggaactgtcaaaggaaaaaagggagtcaag
gaggccaaggtcaataactccggtaaagaggacgcctccaaaccaaagcagcacagcaag
aagaagaggatcatcaatgactcagactcagagtcagaggagacagtacaggtaaaaaat
gctaaaaagaaatcagaaaaattgtcactgtcttataaacctggtaaagtctctcagaag
gatcctgtcacctacgtctctgagacagatgaagatgatgactttgtatgtaaaaaggca
gcctccaaatcaaaagagaatggagtatctacaaatagttaccttggaacatcaaacgtg
aaaaaaaatgaagaaaacgttaagactaagaacaagccgttatctccaataaaactcaca
ccaacgtcagtgctcgactattttggaactgaaagtgtccagagatctgggaagaagatg
gtgacaagcaaaaggaaagaatcttctcaaaacacagaggattccagattaaatgatgag
gccatcgccaagcagctgcagctggatgaagatgcagagctggagaggcagttgcatgaa
gatgaagaatttgcaagaacactggccttattggatgaagaacccaagatcaaaaaggcc
cgaaaggattctgaagagggagaagaatcattttcatctgtccaagatgatttaagcaaa
gcagaaaagcagaaaagccctaataaagccgagcttttctcaactgcaagaaagacctac
agtcctgctaagcatggcaaggggagggcttcagaagatgctaagcagccttgcaaatca
gctcaccggaaggaagcctgttcctcacccaaggccagtgccaaactggcgcttatgaaa
gcaaaagaagaaagttcttacaacgaaacagagctgctggctgcaagaagaaaagaaagc
gccactgaacccaaaggagagaaaacaactcctaagaaaacgaaagtttctccaactaag
agagagtctgtaagcccagaagactctgaaaagaagcgcactaattatcaagcttatcga
agctacttgaaccgagaaggtcccaaagctctgggctccaaagaaatacccaagggagct
gaaaattgcttggaaggcctgacgtttgtgatcacaggagtgctggagtccattgaacga
gacgaagccaagtctctaattgaacgttatggggggaaagtaacaggaaacgtgagcaag
aaaaccaactacctcgtcatgggccgcgacagtgggcagtccaagagtgacaaggcagca
gctctgggaacaaaaatcctcgatgaagacggcctgttggatctgattcgaactatgcca
ggcaagagatccaagtatgagatggctgctgaggctgagatgaagaaagaaaagtccaaa
ttggagcgaacaccccaaaaaaatgatcaaggaaaaagaaaaattagtccagccaagaag
gagtcagagtctaaaaagtgcaagctgactctcctaaagaacagtcctatgaaggcagtg
aagaaggaggcaagcacgtgcccaaggggcctggatgtcaaggagacacatggcaaccgc
agtagcaacaaagaggaatgtctgctctgggtggataagtacaagcccgcctcactcaag
aacataatcggacagcagggtgaccagagctgtgccaacaaattactacgttggctcaga
aactggcacaagagttctcctgaagagaaaaaacatgcagcaaagtttggcaaacttgcc
agcaaagatgatggctccagtttcaaggcagctctgctgtctggccctccaggtgttggc
aaaaccactacagcttctcttgtgtgtcaggaattgggctacagttatgtggaactaaat
gcaagtgatactcggagtaagaacagtttgaaagcagttgttgctgaatccttgaacaac
accagcatcaaaggcttttatacaagtggagcggctccttccgtgagtgcgaggcacgcc
ctcatcatggatgaggtcgatggcatggcaggcaatgaagacaggggtggaattcaggag
ctaataggcctgataaagcatactaaaattcccatcatttgtatgtgcaatgatagaaac
caccccaaaattcgctcattggttcattattgttttgatcttcgtttccaaagacctcga
gttgaacagattaagagtgcaatgctgtctattgcatttaaagagggtttaaaaatcccc
cctccagctatgaatgaaataattttgggagctaatcaagatgtcagacaggttttacac
aatctcagtatgtggtgtgcacaaagtaaggccctgacctatgaccaagccaaggctgat
tctcagagggctaagaaggatatcagactgggcccatttgatgtcactcggaaagtgttt
gcagctggagaggagactgcacacatgtcactgatggacaagtcagatctcttcttccat
gactattccatagcacccctctttgtccaggagaactacctgcatgtaaagcctgtggct
gcaggaggtgacatgaaaaagcacttgatgcttttaagccgggcagcagatagcatatgt
gacggtgacttagtggacaatcagatccggagtaagcaaaactggagtcttctgcccacc
caggccatctatgccagtgttcttcctggagagttgatgcggggctacatgactcagttt
ccgagcttcccgagctggctggggaagcactcgtctacgggcaaacatgatcggattgtt
caggacctatccttgcacatgagtcttagaacttactccagcaaaaggacagtgaacatg
gattacctgtcacacatcagagacgcacttgtacgacccttgacctcacaaggggtagaa
ggggctcagcatgtcatcaaacttatggacacatactatctgatgaaagaagattttgag
aacatcatggaagttagcagctgggggggcaagcccagtgccttttccaagctggatccc
aaggtgaaagcggccttcacaagagcctacaataaggaggcccacctgaccccatactca
cttcaggtagtaaagacatcgaggctcagcacgggtccagcactggattctgagtacagt
gaggagttccaggaagatgacactcagtctgagaaagagcaggatgcagtggagactgac
gccatgatcaagaaaaagacaagatcttcaaaaccttcaaagtcagaaagagagaaggag
tccaaaaaaggaaaaggaaagaattggaagaaatga

KEGG   Mus musculus (mouse): 19718
Entry
19718             CDS       T01002                                 

Gene name
Rfc2, 2610008M13Rik, 40kD, 40kDa, AI326953, Recc, Recc2
Definition
(RefSeq) replication factor C (activator 1) 2
  KO
K10755  replication factor C subunit 2/4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    19718 (Rfc2)
   03420 Nucleotide excision repair
    19718 (Rfc2)
   03430 Mismatch repair
    19718 (Rfc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    19718 (Rfc2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    19718 (Rfc2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    19718 (Rfc2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    19718 (Rfc2)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     19718 (Rfc2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    19718 (Rfc2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     19718 (Rfc2)
  Check point factors
   HRAD17(Rad24)-RFC complex
    19718 (Rfc2)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 AAA_14 AAA_16 AAA_22 Viral_helicase1 Mg_chelatase AAA_24 AAA_11 Rad17 AAA_19 RuvB_N AAA_assoc_2 AAA_18 AAA_5 AAA_25 MipZ DEAD T2SSE ABC_tran AAA_30 AAA_28 NTPase_1 MeaB AAA_23 RNA_helicase DUF3383 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 19718
NCBI-ProteinID: NP_064406
MGI: 1341868
Ensembl: ENSMUSG00000023104
Vega: OTTMUSG00000055749
UniProt: Q9WUK4 Q4KL82
Position
5 G2; 5 74.68 cM
AA seq 349 aa
MEVQESGCDPSESGAQEPSPVPSKTAGHYELPWVEKYRPLKLNEIVGNEDTVSRLEVFAR
EGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAVLELNASNDRGIDVVRNKIKMFAQ
QKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRC
AVLRYTKLTDAQVLTRLMNVIEKEKVPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGFGY
INSENVFKVCDEPHPLLVKEMIQHCVDANIDEAYKILAHLWHLGYSPEDVIGNIFRVCKT
FPMAEYLKLEFIKEIGYTHMKVAEGVNSLLQMAGLLARLCQKTMAPVAS
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggaggttcaggagagtggctgtgacccatccgagagtggggcgcaggagccctcgcct
gtccccagcaagaccgccggccactacgagctgccgtgggttgaaaaatacagaccattg
aagctcaacgaaatagtgggcaatgaagacactgtgagcaggctggaggtctttgcaaga
gaaggcaatgtgcccaatatcatcattgctggtcccccaggaactggcaagacaaccagc
atcctctgcttggctcgagccttgctgggccccgccctgaaggacgcagtcctggaactc
aatgcctcaaatgacaggggcatcgatgtggtgaggaataaaatcaaaatgttcgcccag
cagaaagtcacccttcccaagggccggcacaagatcatcattctagatgaagcagacagc
atgacggacggtgcccagcaggccctcaggagaaccatggaaatctactcgaagacgacc
cgattcgctttggcgtgtaatgcttcagacaaaatcatagagcccatccagtcccgctgt
gcggtgctccgctacaccaagctcactgacgctcaggtcctcaccaggctcatgaatgtc
atcgagaaggaaaaggtgccatacacagatgacggcctggaagccattatcttcacagcc
cagggagacatgcgccaggcactgaacaacctgcagtccaccttctcaggatttggctat
atcaacagtgagaatgtattcaaggtctgcgacgagccccaccccctgctggtgaaggag
atgatccagcactgcgtggacgccaacattgacgaggcctataagattcttgctcacctg
tggcacctgggctactcaccagaagatgtcatcggcaacattttccgagtctgcaaaacc
ttcccgatggctgaatacttgaaactggagttcatcaaggagattggatacactcacatg
aaagtggcggaaggagtgaactccctgctgcagatggctgggctcctggccaggctgtgt
cagaagaccatggctccagtggccagctga

KEGG   Mus musculus (mouse): 69263
Entry
69263             CDS       T01002                                 

Gene name
Rfc3, 2810416I22Rik, 38kD, 38kDa, AU022547, Recc, Recc3
Definition
(RefSeq) replication factor C (activator 1) 3
  KO
K10756  replication factor C subunit 3/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    69263 (Rfc3)
   03420 Nucleotide excision repair
    69263 (Rfc3)
   03430 Mismatch repair
    69263 (Rfc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    69263 (Rfc3)
   03036 Chromosome and associated proteins [BR:mmu03036]
    69263 (Rfc3)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    69263 (Rfc3)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    69263 (Rfc3)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     69263 (Rfc3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    69263 (Rfc3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     69263 (Rfc3)
  Check point factors
   HRAD17(Rad24)-RFC complex
    69263 (Rfc3)
SSDB
Motif
Pfam: DNA_pol3_delta2 Rad17 AAA AAA_16 Rep_fac_C AAA_22 ABC_tran ATPgrasp_ST AAA_19 Sigma54_activ_2 AAA_5 DUF2247 CHB_HEX
Other DBs
NCBI-GeneID: 69263
NCBI-ProteinID: NP_081285
MGI: 1916513
Ensembl: ENSMUSG00000033970
Vega: OTTMUSG00000028751
UniProt: Q8R323 Q3TKD1
Position
5; 5 G3
AA seq 356 aa
MSLWVDKYRPSSLARLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELY
GIGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQ
LETSSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCL
AVRVPAPSIEDICSVLSTVCRKEGLALPSTLARRLAEKSCRNLRKALLMCEACRVQQYPF
TEDQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELL
HNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagcctctgggtggacaagtaccggccgagctcccttgcccggctggactatcataag
gaacaggcagcacagctgcgcaacctggtgcagtgtggagactttcctcacctcttagta
tatggaccatcaggtgctggaaaaaagacaagaattatgtgtattctacgtgaactttat
ggtatcggggtggaaaaactgagaattgagcatcagactatcacaaccccgtctaaaaaa
aaaattgaaatcagcaccattgcaagcaactaccaccttgaagttaatcccagtgatgcg
gggaacagcgaccgagttgtaattcaggagatgctgaagacagtggcccagtcacaacaa
cttgaaaccagctcacaaagagacttcaaagtggtattattgacagaggtggacaaactc
acaaaggatgctcagcatgccttacgcagaactatggagaaatacatgtctacctgcagg
ctcatcttgtgctgcaattccacatccaaggtgatacccccgatccgaagcaggtgcctg
gcagttcgtgtgcctgctcccagcatcgaagatatttgcagtgtactatccactgtctgc
aggaaggaaggtctggctctcccttcgacattggcccgtaggctggccgagaagtcatgc
cgaaacctcaggaaagccttacttatgtgtgaggcctgcagagtgcagcaataccctttt
acggaagaccaagaaatcccagagacagactgggaggtgtatctgagggagaccgcaaat
gctattgtcagtcagcagacgccacagaggctccttgaagtccgtggaaggctctatgag
cttctaactcattgtattcctcctgagattataatgaagggcctcctctcagaactcctc
cataactgtgatgggcagctgaaaggggaagtggcacagatggcagcctactatgagcac
cgactacagctgggcagcaaagccatttatcatttggaagcatttgtggcgaagtttatg
gcactttataagaagttcatggaggatggactggaaggcatgatgttctga

KEGG   Mus musculus (mouse): 72151
Entry
72151             CDS       T01002                                 

Gene name
Rfc5, 2610020K06Rik, 2610209F07Rik, 36.5kD, 36.5kDa, 36kD, 36kDa, Recc, Recc5
Definition
(RefSeq) replication factor C (activator 1) 5
  KO
K10756  replication factor C subunit 3/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    72151 (Rfc5)
   03420 Nucleotide excision repair
    72151 (Rfc5)
   03430 Mismatch repair
    72151 (Rfc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    72151 (Rfc5)
   03036 Chromosome and associated proteins [BR:mmu03036]
    72151 (Rfc5)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    72151 (Rfc5)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    72151 (Rfc5)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     72151 (Rfc5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    72151 (Rfc5)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     72151 (Rfc5)
  Check point factors
   HRAD17(Rad24)-RFC complex
    72151 (Rfc5)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 AAA_24 AAA_16 AAA_11 AAA_assoc_2 AAA_22 RuvB_N AAA_19 ResIII DNA_pol3_delta DUF815 AAA_14 AAA_5 DEAD AAA_30 PhoH TniB TIP49 AAA_7 ATPase_2 Mg_chelatase bpMoxR AAA_25 T2SSE AAA_3 Thioredoxin_6
Other DBs
NCBI-GeneID: 72151
NCBI-ProteinID: NP_082404
MGI: 1919401
Ensembl: ENSMUSG00000029363
Vega: OTTMUSG00000025772
UniProt: Q9D0F6 Q5HZI8
Position
5; 5 F
AA seq 339 aa
MTAAAPSQQRPAAARARNLPWVEKYRPQTLADLISHQDILSTIQKFISEDRLPHLLLYGP
PGTGKTSTILACAKQLYKDKEFGSMVLELNASDDRGIDIVRGPILSFASTRTIFKKGFKL
VILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPEL
MVPRLEHVVQEENVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGH
PLKTDIANILDWMLNQDFTTAYKNIMELKTLKGLALHDILTEVHLFVHRVDFPSSVRIHL
LTKMADIEYRLSVGTSEKIQLSSLIAAFQVTRDLIVAEA
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgacggcggccgcgccttcgcagcagcggcccgcggcggcccgggcccggaacctgccc
tgggttgagaagtaccggccacagaccctggccgatctcatttctcaccaggacattctg
agtaccattcagaagttcatcagtgaagaccgcctgccacacctacttctctatggccct
ccagggacaggaaagacatccaccatcctggcctgtgccaagcaactgtacaaagataaa
gaatttggctccatggtcttggagctgaatgcttctgacgaccgagggatcgatattgtt
cgggggccaatcctcagctttgccagcacaaggacaatcttcaagaaagggtttaagctt
gtgatcctggacgaagccgacgccatgactcaggatgcccagaacgccttgagacgagtg
attgagaagttcacagaaaacaccaggttctgcctcatctgtaactacctgtccaagatc
atccctgccttgcagtctcggtgcacgaggttccgatttggccctctgacacccgagctc
atggtccctcgactggaacatgtagtacaagaagagaatgtggatataagtgaagatgga
atgaaggcccttgtcactctgtccagtggggacatgcgaagggctttgaacatccttcag
agtaccaatatggcctttgggaaggtgacagaggagactgtctacacctgcaccggacac
ccactcaagacggacattgccaatatactggactggatgctcaatcaggacttcaccact
gcctacaaaaacatcatggagctgaagactctgaagggcttggcgctgcatgacatcctg
acagaggttcacttgtttgtacacagagttgactttccatcttcagttcggatacactta
ttgaccaaaatggcagacatcgagtacagactttctgttggcaccagtgagaagatacag
ctgagctccctcatcgccgcttttcaagtcaccagagacctgatagttgcagaggcctag

DBGET integrated database retrieval system