KEGG   Mus musculus (mouse): 106344
Entry
106344            CDS       T01002                                 

Gene name
Rfc4, A, A1, AI894123, AU040575, RFC3, RFC37
Definition
(RefSeq) replication factor C (activator 1) 4
  KO
K10755  replication factor C subunit 2/4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    106344 (Rfc4)
   03420 Nucleotide excision repair
    106344 (Rfc4)
   03430 Mismatch repair
    106344 (Rfc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    106344 (Rfc4)
   03036 Chromosome and associated proteins [BR:mmu03036]
    106344 (Rfc4)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    106344 (Rfc4)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    106344 (Rfc4)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     106344 (Rfc4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    106344 (Rfc4)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     106344 (Rfc4)
  Check point factors
   HRAD17(Rad24)-RFC complex
    106344 (Rfc4)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 AAA_16 DUF815 AAA_assoc_2 AAA_11 AAA_24 AAA_30 AAA_22 DNA_pol3_delta AAA_19 Mg_chelatase RuvB_N DUF2075 AAA_23 AAA_5 HrcA_DNA-bdg ResIII AAA_28 AAA_7 DUF2096
Other DBs
NCBI-GeneID: 106344
NCBI-ProteinID: NP_663455
MGI: 2146571
Ensembl: ENSMUSG00000022881
Vega: OTTMUSG00000025290
UniProt: Q99J62
Position
16; 16 B1
AA seq 364 aa
MQAFLKGTSVSAKAQLTKDRGTPATAGSSGETKKVKPVPWVEKYRPKCVDEVAFQDEVVA
VLRKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVR
EKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLIC
NYVSRIIEPLTSRCSKFRFKPLSDKIQQERLLDIAEKENVKIGNEEIAYLVKISEGDLRK
AITFLQSATRLTGGKEVSEDVITDIAGVIPAATIDGIFTACHSGSFDKLEAVVKNLIDEG
HAATQLVNQLHDAIIENENLSDKHKSIITEKLAEVDKCLADGADEHLQLMSLCATVMQQL
TQNC
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgcaggcatttctgaaaggcacatctgtcagtgccaaagcacaactgaccaaggaccgg
gggacacctgccactgcaggaagcagtggagaaaccaagaaagtcaaaccagttccttgg
gtggaaaaataccgtccaaagtgtgtggatgaagtggctttccaggacgaagtggttgca
gtgctgagaaagtccttagaaggagctgaccttcctaatctcttgttctatgggccacct
ggaactggcaaaacatccaccattttggcagcagctagagagctctttgggcctgaactc
tttcgattaagagtccttgagttaaatgcatctgatgaacgtggaatacaagtagtccga
gagaaagtgaaaaattttgctcagttaactgtatcaggaagtcgttcagatgggaagcca
tgtcctccctttaagattgtaattctggatgaagcagattcgatgacttcagctgctcag
gcagctttaaggcgtaccatggaaaaagaatcaaaaacaaccagattctgcctcatctgt
aactatgtcagtcgaataattgaacccctcacttctagatgttcaaaattccgcttcaag
cctctgtcagataagattcaacaggagcgattactggatattgctgagaaggaaaatgtc
aaaattggcaatgaggaaatagcgtatcttgttaagatatcagaaggagatttacggaaa
gccatcacatttcttcagagtgccactcgactaacaggtggaaaggaagtctctgaagat
gtgatcacagacattgctggggtaataccagctgcaaccattgatggaatattcactgca
tgtcacagtggctcttttgacaaactagaagctgtggtaaagaacctcatagatgaagga
catgcagctactcagcttgtcaatcaacttcatgatgcaattatagaaaatgaaaatctg
tctgataaacacaagtccattatcacagagaaacttgctgaagtagacaagtgcttggca
gatggtgcagatgaacacctgcagttgatgagcctttgtgcaactgtgatgcagcagcta
actcagaactgttag

KEGG   Mus musculus (mouse): 19718
Entry
19718             CDS       T01002                                 

Gene name
Rfc2, 2610008M13Rik, 40kD, 40kDa, AI326953, Recc, Recc2
Definition
(RefSeq) replication factor C (activator 1) 2
  KO
K10755  replication factor C subunit 2/4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    19718 (Rfc2)
   03420 Nucleotide excision repair
    19718 (Rfc2)
   03430 Mismatch repair
    19718 (Rfc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    19718 (Rfc2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    19718 (Rfc2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    19718 (Rfc2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    19718 (Rfc2)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     19718 (Rfc2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    19718 (Rfc2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     19718 (Rfc2)
  Check point factors
   HRAD17(Rad24)-RFC complex
    19718 (Rfc2)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 AAA_14 AAA_16 AAA_22 AAA_24 Viral_helicase1 Mg_chelatase AAA_11 Rad17 RuvB_N AAA_19 AAA_assoc_2 AAA_18 AAA_5 AAA_25 MipZ T2SSE DEAD ABC_tran AAA_30 AAA_28 NTPase_1 DUF3383 MeaB DNA_pol3_delta RNA_helicase AAA_23 FtsK_SpoIIIE DUF815
Other DBs
NCBI-GeneID: 19718
NCBI-ProteinID: NP_064406
MGI: 1341868
Ensembl: ENSMUSG00000023104
Vega: OTTMUSG00000055749
UniProt: Q9WUK4 Q4KL82
Position
5 G2; 5 74.68 cM
AA seq 349 aa
MEVQESGCDPSESGAQEPSPVPSKTAGHYELPWVEKYRPLKLNEIVGNEDTVSRLEVFAR
EGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAVLELNASNDRGIDVVRNKIKMFAQ
QKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRC
AVLRYTKLTDAQVLTRLMNVIEKEKVPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGFGY
INSENVFKVCDEPHPLLVKEMIQHCVDANIDEAYKILAHLWHLGYSPEDVIGNIFRVCKT
FPMAEYLKLEFIKEIGYTHMKVAEGVNSLLQMAGLLARLCQKTMAPVAS
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggaggttcaggagagtggctgtgacccatccgagagtggggcgcaggagccctcgcct
gtccccagcaagaccgccggccactacgagctgccgtgggttgaaaaatacagaccattg
aagctcaacgaaatagtgggcaatgaagacactgtgagcaggctggaggtctttgcaaga
gaaggcaatgtgcccaatatcatcattgctggtcccccaggaactggcaagacaaccagc
atcctctgcttggctcgagccttgctgggccccgccctgaaggacgcagtcctggaactc
aatgcctcaaatgacaggggcatcgatgtggtgaggaataaaatcaaaatgttcgcccag
cagaaagtcacccttcccaagggccggcacaagatcatcattctagatgaagcagacagc
atgacggacggtgcccagcaggccctcaggagaaccatggaaatctactcgaagacgacc
cgattcgctttggcgtgtaatgcttcagacaaaatcatagagcccatccagtcccgctgt
gcggtgctccgctacaccaagctcactgacgctcaggtcctcaccaggctcatgaatgtc
atcgagaaggaaaaggtgccatacacagatgacggcctggaagccattatcttcacagcc
cagggagacatgcgccaggcactgaacaacctgcagtccaccttctcaggatttggctat
atcaacagtgagaatgtattcaaggtctgcgacgagccccaccccctgctggtgaaggag
atgatccagcactgcgtggacgccaacattgacgaggcctataagattcttgctcacctg
tggcacctgggctactcaccagaagatgtcatcggcaacattttccgagtctgcaaaacc
ttcccgatggctgaatacttgaaactggagttcatcaaggagattggatacactcacatg
aaagtggcggaaggagtgaactccctgctgcagatggctgggctcctggccaggctgtgt
cagaagaccatggctccagtggccagctga

DBGET integrated database retrieval system