KEGG   Mus musculus (house mouse): 106504
Entry
106504            CDS       T01002                                 
Symbol
Stk38, 5830476G13Rik, 9530097A09Rik, Ndr1
Name
(RefSeq) serine/threonine kinase 38
  KO
K08790  serine/threonine kinase 38 [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    106504 (Stk38)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106504 (Stk38)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  NDR family
   106504 (Stk38)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_C Kinase-like APH Haspin_kinase Kdo
Other DBs
NCBI-GeneID: 106504
NCBI-ProteinID: NP_598876
MGI: 2442572
Ensembl: ENSMUSG00000024006
UniProt: Q91VJ4
Position
17:complement(29189854..29226979)
AA seq 465 aa
MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDE
EKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKIL
RKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMK
KDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKA
HRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYN
KLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPVSEKAKGLILRF
CCEWEHRIGAPGVEEIKNNLFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILK
PTVTTSSHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggcaatgacaggatcaacaccttgctcatccatgagtaatcatacgaaggagagggtg
acaatgaccaaagtgacactggagaatttttatagcaaccttatcgctcaacatgaagaa
cgagaaatgagacaaaagaagttagaaaaggtgatggaagaagaaggcctgaaagacgaa
gagaaacgactcagaagatccgcgcacgctcggaaggaaacagagtttcttcgattaaag
agaacaaggcttggactggaagattttgagtctttaaaagtcataggccgaggagcattt
ggtgaggtgcggcttgttcagaagaaagacacagggcatgtgtacgcaatgaaaatcctg
cgcaaagcagacatgctcgagaaggagcaggttggccacattcgtgcggagcgtgacatt
ctagtggaggcagacagtttgtgggttgtgaaaatgttctatagttttcaggataagcta
aacctctacctaatcatggagttcctgcctggaggggacatgatgactttattgatgaaa
aaagatactctgacagaagaggagactcagttttatatagcagagacagtattagccata
gactccattcaccagctgggattcatccacagagatatcaagccagacaaccttctcttg
gacagcaagggccatgtgaaactttccgactttggcctttgcacaggcctgaaaaaagca
cacaggacagaattttataggaacctgaaccacagcctgcccagtgatttcacttttcag
aacatgaattccaaaaggaaagcagagacctggaaaagaaacagacgccagctagccttc
tctacagtgggcactcctgactacattgctccagaggtgttcatgcagacgggttacaac
aagctctgcgattggtggtcgctcggggtaatcatgtatgagatgctcatcggctaccca
ccattctgctccgagaccccacaagagacatacaagaaagtgatgaactggaaggaaact
ttgacctttcctccagaagttcctgtctccgagaaagccaagggcctgattctgaggttc
tgctgtgaatgggaacatagaatcggagcccctggagttgaagaaataaaaaataatctt
ttttttgaaggtgttgactgggaacacatcagggagagaccagctgcgatatctattgaa
atcaagagcatcgatgatacctcaaacttcgatgaatttccagagtctgatattcttaag
cccacagtgaccacaagtagtcatcctgagacggactacaagaacaaagactgggtcttc
atcaattacacatacaagcgcttcgagggcctgacagccaggggggccataccttcgtac
atgaaagcagcaaaatag

DBGET integrated database retrieval system