KEGG   Mus musculus (house mouse): 106572
Entry
106572            CDS       T01002                                 
Symbol
Rab31, 1700093E07Rik, AI415285, Rab22B
Name
(RefSeq) RAB31, member RAS oncogene family
  KO
K07891  Ras-related protein Rab-22
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106572 (Rab31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    106572 (Rab31)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    106572 (Rab31)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    106572 (Rab31)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    106572 (Rab31)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase MMR_HSR1 GTP_EFTU Gtr1_RagA TniB AAA_7 FeoB_N NACHT AAA_5 AAA_16
Other DBs
NCBI-GeneID: 106572
NCBI-ProteinID: NP_598446
MGI: 1914603
Ensembl: ENSMUSG00000056515
UniProt: Q921E2 Q3TXV4
Position
17:complement(65958721..66079747)
AA seq 195 aa
MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIW
DTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFHTLKKWVKELKEHGPENIVMAIAGNK
CDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLGPQENGNSGG
IKLGNQSLQASRRCC
NT seq 588 nt   +upstreamnt  +downstreamnt
atgatggcgatacgggagctcaaagtgtgtcttctcggggacacgggggttgggaaatcc
agcattgtgtgtcgttttgtccaggatcactttgaccacaacatcagccccactattggg
gcatctttcatgaccaaaaccgtgccttgtggaaatgaacttcacaaattcctcatctgg
gacaccgctggccaggagcggttccactccctggctcctatgtactaccgaggatctgct
gcagccgtcatcgtctatgacatcactaagcaggattcatttcataccttgaaaaaatgg
gtcaaggagctgaaggagcacggcccagaaaacattgtgatggcgattgctgggaacaag
tgtgacctctctgatattagggaggtgcccctgaaggacgctaaggagtacgctgaatcc
ataggtgccatcgtggtggagaccagcgcgaagaatgccattaacatcgaggagctcttt
caaggaatcagccgccagatcccacccttgggccctcaggaaaatggaaacagcggcggg
atcaagcttgggaatcagagcttgcaagccagccgtcggtgctgctga

DBGET integrated database retrieval system