KEGG   Mus musculus (house mouse): 106582
Entry
106582            CDS       T01002                                 
Symbol
Nrm, 2610307M02Rik, AI429796
Name
(RefSeq) nurim (nuclear envelope membrane protein)
Organism
mmu  Mus musculus (house mouse)
SSDB
Other DBs
NCBI-GeneID: 106582
NCBI-ProteinID: NP_598883
MGI: 2146855
Ensembl: ENSMUSG00000059791
UniProt: Q8VC65
Position
17:36171987..36176292
AA seq 262 aa
MAPALLLVPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARHGWLAALQDRSIL
ASLAWDLCLLLLFVVQHSLMATEAVKAWTSRYFGVLQRSLYVACTALALQLVMRYWETTP
RGPVLWEARAEPWATWVPLLCFVLHVVSWLLIFSILLVFDYAELMGLKQVYYHVLGLGEP
LSLKSPRALRLFSHLRHPVCVELLTVLWVVPTLGTDRLLLALLFTLYLGLAHGLDQQDLR
YLRSQLQRKLHLLSRPQDGEAE
NT seq 789 nt   +upstreamnt  +downstreamnt
atggcaccggcgctgctgctggttcctgcggccctcgcctccttcatcctggcctttggc
accggagtggaattcgtgcgtttcacctccctgaggccgctgcttggagggatcccggag
tctggcggtcccgatgcccgccacgggtggttggctgccctgcaggaccggagcattctt
gcctccttggcttgggatctatgtctgctgctactgtttgtggtacagcacagccttatg
gcgactgaggcagtgaaggcgtggacatcccggtactttggcgtccttcagaggtcgctc
tatgtggcgtgcacagccctggccttgcagttggtgatgcggtactgggagactacaccc
agaggcccagtgttatgggaggctcgggctgaaccatgggccacctgggtacctctcctc
tgctttgtgctccacgttgtttcctggctcctcatctttagcatccttctggtctttgac
tacgctgaactgatgggcctcaagcaggtttattaccatgtgctgggactgggcgagccc
ctgtccctgaagtctcctcgggctctgagactcttttcccaccttcgacacccagtgtgt
gtggagctgctgactgtgctgtgggtggtccccaccttgggcaccgatcggctcctcctg
gctcttctctttaccctctacctgggcttggctcatgggcttgaccagcaagatctccgc
taccttcggtctcagctacaaagaaaactccaccttctctccagacctcaggatggggaa
gcagagtga

DBGET integrated database retrieval system