KEGG   Mus musculus (mouse): 106582
Entry
106582            CDS       T01002                                 

Gene name
Nrm, 2610307M02Rik, AI429796
Definition
(RefSeq) nurim (nuclear envelope membrane protein)
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: NnrU
Other DBs
NCBI-GeneID: 106582
NCBI-ProteinID: NP_598883
MGI: 2146855
Ensembl: ENSMUSG00000059791
Vega: OTTMUSG00000037408
UniProt: Q8VC65
Position
17; 17 B1
AA seq 262 aa
MAPALLLVPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARHGWLAALQDRSIL
ASLAWDLCLLLLFVVQHSLMATEAVKAWTSRYFGVLQRSLYVACTALALQLVMRYWETTP
RGPVLWEARAEPWATWVPLLCFVLHVVSWLLIFSILLVFDYAELMGLKQVYYHVLGLGEP
LSLKSPRALRLFSHLRHPVCVELLTVLWVVPTLGTDRLLLALLFTLYLGLAHGLDQQDLR
YLRSQLQRKLHLLSRPQDGEAE
NT seq 789 nt   +upstreamnt  +downstreamnt
atggcaccggcgctgctgctggttcctgcggccctcgcctccttcatcctggcctttggc
accggagtggaattcgtgcgtttcacctccctgaggccgctgcttggagggatcccggag
tctggcggtcccgatgcccgccacgggtggttggctgccctgcaggaccggagcattctt
gcctccttggcttgggatctatgtctgctgctactgtttgtggtacagcacagccttatg
gcgactgaggcagtgaaggcgtggacatcccggtactttggcgtccttcagaggtcgctc
tatgtggcgtgcacagccctggccttgcagttggtgatgcggtactgggagactacaccc
agaggcccagtgttatgggaggctcgggctgaaccatgggccacctgggtacctctcctc
tgctttgtgctccacgttgtttcctggctcctcatctttagcatccttctggtctttgac
tacgctgaactgatgggcctcaagcaggtttattaccatgtgctgggactgggcgagccc
ctgtccctgaagtctcctcgggctctgagactcttttcccaccttcgacacccagtgtgt
gtggagctgctgactgtgctgtgggtggtccccaccttgggcaccgatcggctcctcctg
gctcttctctttaccctctacctgggcttggctcatgggcttgaccagcaagatctccgc
taccttcggtctcagctacaaagaaaactccaccttctctccagacctcaggatggggaa
gcagagtga

DBGET integrated database retrieval system