KEGG   Mus musculus (mouse): 106628
Entry
106628            CDS       T01002                                 

Symbol
Trip10, AI646975, Cip4
Name
(RefSeq) thyroid hormone receptor interactor 10
  KO
K07196  thyroid hormone receptor interactor 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106628 (Trip10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    106628 (Trip10)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    106628 (Trip10)
SSDB
Motif
Pfam: FCH SH3_1 SH3_9 SH3_3 SH3_2 SH3_4 DUF481
Other DBs
NCBI-GeneID: 106628
NCBI-ProteinID: NP_001229318
MGI: 2146901
Ensembl: ENSMUSG00000019487
UniProt: Q8CJ53
Position
17; 17 D
AA seq 603 aa
MDWGTELWDQFEVLERHTQWGLDLLDKYVKFVKERAEVEQAYAKQLRSLVKKYLPKRPTK
DDPEVKFSQQQSFVQLLQEVNDFAGQRELVAESLGIRVCLELAKYSQEMKQERKMHFQEG
RRAQQQLENGFKQLENSKRKFERDCREAEKAAHTAERLDQDINATKADVEKAKQQAHLRN
HMAEESKNEYAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELQ
VVPIIGKCLEGMKVAAESVDAKNDSQVLIELHKSGFARPGDLEFEDFSQVINRVPSDSSL
GTPDGRPELRAASSRSRAKRWPFGKKNKPRPPSLSLLGGHLPSTLSDGPSSPRSGRDPLA
ILSEISKSVKPRLASFRSFRGGRGTVATEDFSHLPPEQQRKRLQQQLEERNRELQKEEDQ
REALKKMKDVYEKTPQMGDPASLEPRIAETLGNIERLKLEVQKYEAWLAEAESRVLSNRG
DSLSRHARPPDPPTTAPPDSSSSSTNSGSQDNKESSSEEPPSEGQDTPIYTEFDEDFEEP
ASPIGQCVAIYHFEGSSEGTVSMSEGEDLSLMEEDKGDGWTRVRRKQGAEGYVPTSYLRV
TLN
NT seq 1812 nt   +upstreamnt  +downstreamnt
atggattggggtaccgagttgtgggatcagtttgaggtgctggaacgccacacgcagtgg
gggctggatttgttggacaaatacgtgaagttcgtgaaagaacgcgcggaggtggagcag
gcttatgctaagcaactccggagcctggtgaaaaagtatcttcccaagagacctaccaaa
gatgaccctgaagtcaagttcagccagcagcagtcatttgtccagcttctccaggaggtc
aatgacttcgcaggccagagagagctggtggctgagagcctcggtatccgagtgtgtctg
gagctggctaagtattcacaggagatgaagcaggagaggaagatgcacttccaggaaggt
cgtcgggcccagcagcagctggagaatggcttcaaacagctggagaatagtaagcggaag
tttgaacgagattgccgggaggctgagaaagcggctcacactgctgagcgcctagatcag
gacattaatgccaccaaggcggatgtggagaaggccaagcagcaagctcaccttcggaac
cacatggcagaagagagcaagaatgaatatgcggcccagctgcagcgcttcaaccgagac
caggctcacttctacttctcacagatgccccagatattcgataagctgcaggacatggac
gaacgccgggccacccgcctgggggccgggtatgggctcttatcagaggctgaactgcag
gtggttcccattattggcaaatgcttggagggcatgaaggtggccgccgagtctgtggat
gctaagaacgactcacaggtcctcatcgaattacacaagtccgggtttgcccgcccaggg
gacttggaatttgaagactttagccaagttatcaaccgagtgccttcggacagcagcctg
ggcaccccggatggcaggcctgagctccgagcagcctccagccgtagccgcgccaagcgt
tggcctttcgggaaaaagaacaagccacgtcccccatccctgtccctcctggggggtcac
ctaccctccacactgtctgatggaccctcatccccccgttctggccgcgaccccttggcc
atactgagcgagatcagtaagtcggtcaaaccgcggctagcatccttccgcagcttccga
ggtggccgtgggaccgtggctaccgaagatttcagtcacttgcccccggagcagcagaga
aagcgacttcagcaacagctggaagagcggaaccgagagttgcagaaggaggaggaccag
agggaggccctgaagaagatgaaagatgtatatgagaaaacaccacaaatgggggaccct
gccagcttagagccccgcattgcagagaccctgggcaacattgagaggctgaagttggaa
gtgcagaagtatgaggcttggttggcagaagctgaaagccgggtcctcagtaaccgaggg
gacagcctaagccgtcacgctaggccccctgatcccccaactactgccccacctgatagc
agcagtagcagcaccaacagtggatcccaggacaataaggagagcagctcagaagagccc
ccttcagaaggccaggacacccccatctatactgagttcgatgaggactttgaggagcct
gcatcccctatcggccagtgtgtggctatctaccattttgaaggatccagcgagggaacc
gtctccatgtccgagggggaagacctcagcctgatggaggaagacaagggtgatggatgg
acgcgggtcaggaggaaacagggagctgagggctacgtgcccacctcttacctccgagtc
acactcaactga

DBGET integrated database retrieval system