KEGG   Mus musculus (house mouse): 106648
Entry
106648            CDS       T01002                                 
Symbol
Cyp4f15, Cyp4f-15
Name
(RefSeq) cytochrome P450, family 4, subfamily f, polypeptide 15
  KO
K00490  cytochrome P450 family 4 subfamily F [EC:1.14.14.1]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    106648 (Cyp4f15)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     106648 (Cyp4f15)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP4 family
   106648 (Cyp4f15)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 106648
NCBI-ProteinID: NP_001333467
MGI: 2146921
Ensembl: ENSMUSG00000073424
UniProt: Q8VCA4
Position
17:32904605..32922329
AA seq 527 aa
MGFFRMPQLDLSWLGLRLEASSPWLLLLLIGASWLLARVLTQTYIFYRTYHHLCDFPQPP
KWNWFLGHLGMITPTEHGLKEVTNLVATYPQGFMTWLGPIIPIITLCHPDIIRSVLNASA
SVALKEVVFYSFLKPWLGDGLLLSDGDKWSSHRRMLTPAFHFNILKPYVKIFNDSTNIMH
AKWQHLASGGSARLDVFENISLMTLDSLQKCVFSFDSNCQENPSEYISAILELSALVTKR
YHQLLLHIDSLYQLTCSGRRFHKACHLVHSFTDAVIQDRRRTLPSKHEDDVLKAKAKSKT
LDFIDVLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLARHPEYQERCR
QEVQELLRDRESTEIEWDDLAQLPFLTMCIKESLRLHPPVTVISRRCTQDIVLPDGRVIP
KGVICIINIFATHHNPTVWPDPEVYDPFRFDPENIKDRSPLAFIPFSAGPRNCIGQTFAM
NEMKVALALTLLRFRVLPDDKEPRRKPELILRAEGGLWLRVEPLSTQ
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggggtttttcaggatgccacagttggacctgtcttggctgggactgaggctggaggca
tcctcaccatggctgcttttgctgctgatcggagcttcctggctcttggcccgtgtcctg
actcagacctatatcttctacagaacatatcatcatctttgtgatttccctcaacccccc
aaatggaattggttcttgggtcacctaggcatgatcacacccactgagcatggtctgaag
gaggtgactaacctggtggccacctacccccagggcttcatgacatggctgggtcctatc
attcctatcatcactctgtgccaccctgacatcattcgatctgttctcaatgcctcagct
tcggtagccctaaaggaagtagtcttctacagtttcctgaaaccttggctgggggatggg
ctcttgctgagtgatggtgacaagtggagcagccaccgtcgcatgttgacacctgctttc
catttcaacatcctaaaaccctatgtgaagattttcaatgacagcaccaacataatgcat
gccaagtggcagcacctggcctcaggtggcagcgcccgtctggatgtgtttgagaacatc
agcctcatgaccttggacagcctgcagaaatgtgtcttcagttttgatagcaactgccag
gagaatcccagtgagtatatttctgccatcttggagctcagtgccttagtgaccaaacgg
taccaccagctgcttctacacatagactcactctatcagctcacctgtagtgggcggcgc
ttccacaaggcctgccacctggtgcacagcttcacagatgctgtcatccaggatcgacga
cgtactctccccagtaagcatgaggatgatgtcctcaaggccaaggctaagtccaaaact
ctggatttcattgatgtgctgctgctgagcaaggatgaagatggaaaggagctgtcagat
gaggacattagagcagaggctgacaccttcatgtttgagggccatgacaccacagccagc
gggctctcctggatcctgtacaatctggcaaggcacccagaataccaggagcgctgccgg
caggaggtgcaggagctgctgagggatcgagagtctacagaaattgagtgggacgacttg
gcccagctacccttcctgaccatgtgcatcaaggagagtctgcggctgcatcccccagtc
acggtcatttcccgtcgttgtacccaagacattgtgctcccagatggccgggtcatacct
aaaggtgttatctgcatcatcaatattttcgcgacccatcacaacccaactgtgtggcct
gaccctgaggtttatgaccccttccgctttgacccagagaatatcaaggacaggtcacct
ctggcttttattcccttctccgctgggcccaggaactgcataggacagacgtttgctatg
aacgagatgaaggtggcgctggcgctgacgctgctgcgcttccgtgtgctgccagatgac
aaggagccgcgccggaagcccgagttgatcctgcgcgcagagggcgggctgtggctgcgg
gtggagccgctgagcacacagtga

DBGET integrated database retrieval system